S100A4 Protein, Rat, Recombinant (His & Myc)

Name: S100A4 Protein, Rat, Recombinant (His & Myc)
Brand: TargetMol
SKU: TMPH-03357
Rating: 4.5 (1 reviews)

(Synonyms: S100a4, S100 calcium-binding protein A4, Protein S100-A4, Placental calcium-binding protein, P9K, Nerve growth factor-induced protein 42A, Metastasin) Copy Product Info

Synonyms: S100a4, S100 calcium-binding protein A4, Protein S100-A4, Placental calcium-binding protein, P9K, Nerve growth factor-induced protein 42A, Metastasin

Catalog No. TMPH-03357 Copy Product Info

S100A4 Protein, Rat, Recombinant (His & Myc) is expressed in E. coli expression system with N-10xHis and C-Myc tag. The predicted molecular weight is 18.6 kDa and the accession number is P05942.

Pack Size	Price	USA Stock	Global Stock
5 µg	$129	20 days	20 days
10 µg	$216	20 days	20 days
20 µg	$360	20 days	20 days
50 µg	$543	20 days	20 days
100 µg	$745	20 days	20 days
200 µg	$1,070	20 days	20 days
500 µg	$1,730	20 days	20 days
1 mg	$2,530	20 days	20 days

For In stock only · Estimated delivery: USA Stock (1-2 days) Global Stock (5-7 days)

Add to Cart

Add to Quotation

For research use only—not for human use. No sales to individuals. Use as intended only.

Questions

Resource Download

User Guide of Recombinant Proteins

Product Introduction

Bioactivity

Bioactivity	Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description	S100A4 Protein, Rat, Recombinant (His & Myc) is expressed in E. coli expression system with N-10xHis and C-Myc tag. The predicted molecular weight is 18.6 kDa and the accession number is P05942.
Species	Rat
Expression System	E. coli
Tag	N-10xHis, C-Myc
Accession Number	P05942
Amino Acid	ARPLEEALDVIVSTFHKYSGNEGDKFKLNKTELKELLTRELPSFLGRRTDEAAFQKLMNNLDSNRDNEVDFQEYCVFLSCIAMMCNEFFEGCPDKEPRKK
Construction	2-101 aa
Protein Purity	> 85% as determined by SDS-PAGE.
Endotoxin	< 1.0 EU/μg of the protein as determined by the LAL method.
Formulation	Tris-based buffer, 50% glycerol
Reconstitution	A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Synonyms	S100a4, S100 calcium-binding protein A4, Protein S100-A4, Placental calcium-binding protein, P9K, Nerve growth factor-induced protein 42A, Metastasin
Research Background	Calcium-binding protein that plays a role in various cellular processes including motility, angiogenesis, cell differentiation, apoptosis, and autophagy. Increases cell motility and invasiveness by interacting with non-muscle myosin heavy chain (NMMHC) IIA/MYH9. Mechanistically, promotes filament depolymerization and increases the amount of soluble myosin-IIA, resulting in the formation of stable protrusions facilitating chemotaxis. Modulates also the pro-apoptotic function of TP53 by binding to its C-terminal transactivation domain within the nucleus and reducing its protein levels. Within the extracellular space, stimulates cytokine production including granulocyte colony-stimulating factor and CCL24 from T-lymphocytes. In addition, stimulates T-lymphocyte chemotaxis by acting as a chemoattractant complex with PGLYRP1 that promotes lymphocyte migration via CCR5 and CXCR3 receptors.

Chemical Properties

Molecular Weight

18.6 kDa (predicted)

Storage & Solubility Information

Shipping	In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.