Shopping Cart
Remove All
Your shopping cart is currently empty
Synonyms: SNCG, Gamma-synuclein

| Pack Size | Price | USA Stock | Global Stock | Quantity |
|---|---|---|---|---|
| 5 µg | $158 | 20 days | 20 days | |
| 10 µg | $262 | 20 days | 20 days | |
| 20 µg | $439 | 20 days | 20 days | |
| 50 µg | $598 | 20 days | 20 days | |
| 100 µg | $758 | 20 days | 20 days | |
| 200 µg | $1,080 | 20 days | 20 days | |
| 500 µg | $1,830 | 20 days | 20 days | |
| 1 mg | $2,690 | 20 days | 20 days |
| Bioactivity | Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first. |
| Description | Plays a role in neurofilament network integrity. May be involved in modulating axonal architecture during development and in the adult. In vitro, increases the susceptibility of neurofilament-H to calcium-dependent proteases. May also function in modulating the keratin network in skin. Activates the MAPK and Elk-1 signal transduction pathway. SNCG Protein, Cynomolgus, Recombinant is expressed in E. coli expression system. The predicted molecular weight is 13.3 kDa and the accession number is Q2PFW6. |
| Species | Cynomolgus |
| Expression System | E. coli |
| Tag | Tag Free |
| Accession Number | Q2PFW6 |
| Amino Acid | MDVFKKGFSIAKEGVVGAVEKTKQGVTEAAEKTKEGVMYVGTKTKENVVHSVTSVAEKTKEQANAVSEAVVSSVNTVAAKTVEEAENIAVTSGVVRKEDLKPSAPQQEGEAAKEKEEVAEEAQSGGD |
| Construction | 1-127 aa |
| Protein Purity | > 85% as determined by SDS-PAGE. |
| Endotoxin | < 1.0 EU/μg of the protein as determined by the LAL method. |
| Formulation | Tris-based buffer, 50% glycerol |
| Reconstitution | A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information. |
| Synonyms | SNCG, Gamma-synuclein |
| Research Background | Plays a role in neurofilament network integrity. May be involved in modulating axonal architecture during development and in the adult. In vitro, increases the susceptibility of neurofilament-H to calcium-dependent proteases. May also function in modulating the keratin network in skin. Activates the MAPK and Elk-1 signal transduction pathway. |
| Molecular Weight | 13.3 kDa (predicted) |
| Shipping | In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice. |
| Storage | Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
| Size | Quantity | Unit Price | Amount | Operation |
|---|

Copyright © 2015-2026 TargetMol Chemicals Inc. All Rights Reserved.