SNCG Protein, Cynomolgus, Recombinant

Name: SNCG Protein, Cynomolgus, Recombinant
Brand: TargetMol
SKU: TMPH-02430
Rating: 4.5 (1 reviews)

(Synonyms: SNCG, Gamma-synuclein) Copy Product Info

Synonyms: SNCG, Gamma-synuclein

Catalog No. TMPH-02430 Copy Product Info

Plays a role in neurofilament network integrity. May be involved in modulating axonal architecture during development and in the adult. In vitro, increases the susceptibility of neurofilament-H to calcium-dependent proteases. May also function in modulating the keratin network in skin. Activates the MAPK and Elk-1 signal transduction pathway. SNCG Protein, Cynomolgus, Recombinant is expressed in E. coli expression system. The predicted molecular weight is 13.3 kDa and the accession number is Q2PFW6.

Pack Size	Price	USA Stock	Global Stock
5 μg	$158	20 days	20 days
10 μg	$262	20 days	20 days
20 μg	$439	20 days	20 days
50 μg	$598	20 days	20 days
100 μg	$758	20 days	20 days
200 μg	$1,080	20 days	20 days
500 μg	$1,830	20 days	20 days
1 mg	$2,690	20 days	20 days

For In stock only · Estimated delivery: USA Stock (1-2 days) Global Stock (5-7 days)

Add to Cart

Add to Quotation

For research use only—not for human use. No sales to individuals. Use as intended only.

Questions

Resource Download

User Guide of Recombinant Proteins

Product Introduction

Bioactivity

Bioactivity	Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description	Plays a role in neurofilament network integrity. May be involved in modulating axonal architecture during development and in the adult. In vitro, increases the susceptibility of neurofilament-H to calcium-dependent proteases. May also function in modulating the keratin network in skin. Activates the MAPK and Elk-1 signal transduction pathway. SNCG Protein, Cynomolgus, Recombinant is expressed in E. coli expression system. The predicted molecular weight is 13.3 kDa and the accession number is Q2PFW6.
Species	Cynomolgus
Expression System	E. coli
Tag	Tag Free
Accession Number	Q2PFW6
Amino Acid	MDVFKKGFSIAKEGVVGAVEKTKQGVTEAAEKTKEGVMYVGTKTKENVVHSVTSVAEKTKEQANAVSEAVVSSVNTVAAKTVEEAENIAVTSGVVRKEDLKPSAPQQEGEAAKEKEEVAEEAQSGGD
Construction	1-127 aa
Protein Purity	> 85% as determined by SDS-PAGE.
Endotoxin	< 1.0 EU/μg of the protein as determined by the LAL method.
Formulation	Tris-based buffer, 50% glycerol
Reconstitution	A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Stability & Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
Shipping	In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Synonyms	SNCG, Gamma-synuclein
Research Background

Chemical Properties

Molecular Weight

13.3 kDa (predicted)

Storage & Solubility Information

Storage

Lyophilized powder: -20~-80°C for 1 year | Solution: -80°C for 6 months

Calculator

Molarity Calculator
Dilution Calculator
Reconstitution Calculator
Molecular Weight Calculator

Dose Conversion

You can also refer to dose conversion for different animals. More Dose Conversion

Tech Support

Please see Inhibitor Handling Instructions for more frequently ask questions. Topics include: how to prepare stock solutions, how to store products, and cautions on cell-based assays & animal experiments, etc

Keywords

γ-synucleinγsynucleinG-synuclein

Related Tags: SNCG Protein, Cynomolgus, Recombinant chemical structure | SNCG Protein, Cynomolgus, Recombinant molecular weight