SNCG Protein, Cynomolgus, Recombinant

Catalog No. TMPH-02430

Plays a role in neurofilament network integrity. May be involved in modulating axonal architecture during development and in the adult. In vitro, increases the susceptibility of neurofilament-H to calcium-dependent proteases. May also function in modulating the keratin network in skin. Activates the MAPK and Elk-1 signal transduction pathway. SNCG Protein, Cynomolgus, Recombinant is expressed in E. coli expression system. The predicted molecular weight is 13.3 kDa and the accession number is Q2PFW6.

SNCG Protein, Cynomolgus, Recombinant

Catalog No. TMPH-02430

Pack Size	Price	USA Warehouse	Global Warehouse
5 μg	$158	20 days	20 days
10 μg	$262	20 days	20 days
20 μg	$439	20 days	20 days
50 μg	$598	20 days	20 days
100 μg	$758	20 days	20 days
200 μg	$1,080	20 days	20 days
500 μg	$1,830	20 days	20 days
1 mg	$2,690	20 days	20 days

Add to Cart

Add to Quotation

Expected start date of shipmentUSA Warehouse [1-2 days] Global Warehouse [5-7 days]

All TargetMol products are for research purposes only and cannot be used for human consumption. We do not provide products or services to individuals. Please comply with the intended use and do not use TargetMol products for any other purpose.

Questions

Resource Download

User Guide of Recombinant Proteins

Product Information

Biological Activity	Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description	Plays a role in neurofilament network integrity. May be involved in modulating axonal architecture during development and in the adult. In vitro, increases the susceptibility of neurofilament-H to calcium-dependent proteases. May also function in modulating the keratin network in skin. Activates the MAPK and Elk-1 signal transduction pathway. SNCG Protein, Cynomolgus, Recombinant is expressed in E. coli expression system. The predicted molecular weight is 13.3 kDa and the accession number is Q2PFW6.
Species	Cynomolgus
Expression System	E. coli
Tag	Tag Free
Accession Number	Q2PFW6
Synonyms	SNCG,Gamma-synuclein
Amino Acid	MDVFKKGFSIAKEGVVGAVEKTKQGVTEAAEKTKEGVMYVGTKTKENVVHSVTSVAEKTKEQANAVSEAVVSSVNTVAAKTVEEAENIAVTSGVVRKEDLKPSAPQQEGEAAKEKEEVAEEAQSGGD
Construction	1-127 aa
Protein Purity	> 85% as determined by SDS-PAGE.
Molecular Weight	13.3 kDa (predicted)
Endotoxin	< 1.0 EU/μg of the protein as determined by the LAL method.
Formulation	Tris-based buffer, 50% glycerol
Reconstitution	A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Stability & Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
Shipping	In general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice.
Research Background	Plays a role in neurofilament network integrity. May be involved in modulating axonal architecture during development and in the adult. In vitro, increases the susceptibility of neurofilament-H to calcium-dependent proteases. May also function in modulating the keratin network in skin. Activates the MAPK and Elk-1 signal transduction pathway.