RAB33A Protein, Human, Recombinant (E. coli, His)

Name: RAB33A Protein, Human, Recombinant (E. coli, His)
Brand: TargetMol
SKU: TMPH-04101
Rating: 4.5 (1 reviews)

(Synonyms: Small GTP-binding protein S10, Ras-related protein Rab-33A, RABS10, RAB33A) Copy Product Info

Synonyms: Small GTP-binding protein S10, Ras-related protein Rab-33A, RABS10, RAB33A

Catalog No. TMPH-04101 Copy Product Info

RAB33A Protein, Human, Recombinant (E. coli, His) is expressed in E. coli with C-10xHis. The accession number is Q14088.

Customer service consultation

Pack Size	Price	USA Stock	Global Stock
5 µg	$89	20 days	20 days
10 µg	$143	20 days	20 days
20 µg	$237	20 days	20 days
50 µg	$339	20 days	20 days
100 µg	$446	20 days	20 days
200 µg	$688	20 days	20 days
500 µg	$1,230	20 days	20 days
1 mg	$1,920	20 days	20 days

For In stock only · Estimated delivery: USA Stock (1-2 days) Global Stock (5-7 days)

Add to Cart

Add to Quotation

For research use only—not for human use. No sales to individuals. Use as intended only.

Questions

Resource Download

User Guide of Recombinant Proteins

Product Introduction

Bioactivity

Bioactivity	Activity has not been tested. It is theoretically active, but we cannot guarantee it.
Description	RAB33A Protein, Human, Recombinant (E. coli, His) is expressed in E. coli with C-10xHis. The accession number is Q14088.
Species	Human
Expression System	E. coli
Tag	C-10xHis
Accession Number	Q14088
Amino Acid	MAQPILGHGSLQPASAAGLASLELDSSLDQYVQIRIFKIIVIGDSNVGKTCLTFRFCGGTFPDKTEATIGVDFREKTVEIEGEKIKVQVWDTAGQERFRKSMVEHYYRNVHAVVFVYDVTKMTSFTNLKMWIQECNGHAVPPLVPKVLVGNKCDLREQIQVPSNLALKFADAHNMLLFETSAKDPKESQNVESIFMCLACRLKAQKSLLYRDAERQQGKVQKLEFPQEANSKTSCPC
Construction	1-237 aa
Protein Purity	>95% as determined by SDS-PAGE.
Endotoxin	< 1.0 EU/μg of the protein as determined by the LAL method.
Formulation	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Synonyms	Small GTP-binding protein S10, Ras-related protein Rab-33A, RABS10, RAB33A

Chemical Properties

Molecular Weight

34.1 kDa (Predicted)

Storage & Solubility Information

Shipping	In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.

Calculator

Reconstitution Calculator
Recombinant Protein Dilution Calculator
Specific Activity Calculator

Dose Conversion

You can also refer to dose conversion for different animals. More Dose Conversion

Tech Support

Please see Recombinant Proteins

Keywords

RABS 10

Related Tags: RAB33A Protein, Human, Recombinant (E. coli, His) chemical structure | RAB33A Protein, Human, Recombinant (E. coli, His) molecular weight