PERP Protein, Human, Recombinant (His & Myc & SUMO)

Catalog No. TMPH-01823 Copy Product Info

Component of intercellular desmosome junctions. Plays a role in stratified epithelial integrity and cell-cell adhesion by promoting desmosome assembly. Plays a role as an effector in the TP53-dependent apoptotic pathway. PERP Protein, Human, Recombinant (His & Myc & SUMO) is expressed in E. coli expression system with N-10xHis-SUMO and C-Myc tag. The predicted molecular weight is 41.4 kDa and the accession number is Q96FX8.

PERP Protein, Human, Recombinant (His & Myc & SUMO)

Catalog No. TMPH-01823

Copy Product Info

PERP Protein, Human, Recombinant (His & Myc & SUMO)

Pack Size	Price	USA Stock	Global Stock
5 μg	$526	20 days	20 days
10 μg	$886	20 days	20 days
20 μg	$1,500	20 days	20 days
50 μg	$2,090	20 days	20 days
100 μg	$2,750	20 days	20 days

Add to Cart

Add to Quotation

For In stock only · Estimated delivery:USA Stock (1-2 days) Global Stock (5-7 days)

For research use only—not for human use. No sales to individuals. Use as intended only.

Questions

Batch Information

Resource Download

User Guide of Recombinant Proteins

Product Information

Biological Activity	Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description	Component of intercellular desmosome junctions. Plays a role in stratified epithelial integrity and cell-cell adhesion by promoting desmosome assembly. Plays a role as an effector in the TP53-dependent apoptotic pathway. PERP Protein, Human, Recombinant (His & Myc & SUMO) is expressed in E. coli expression system with N-10xHis-SUMO and C-Myc tag. The predicted molecular weight is 41.4 kDa and the accession number is Q96FX8.
Species	Human
Expression System	E. coli
Tag	N-10xHis-SUMO, C-Myc
Accession Number	Q96FX8
Synonyms	Transmembrane protein THW,THW,PIGPC1,PERP,P53-induced protein PIGPC1,p53 apoptosis effector related to PMP-22,KRTCAP1,Keratinocyte-associated protein 1 (KCP-1),KCP1
Amino Acid	MIRCGLACERCRWILPLLLLSAIAFDIIALAGRGWLQSSDHGQTSSLWWKCSQEGGGSGSYEEGCQSLMEYAWGRAAAAMLFCGFIILVICFILSFFALCGPQMLVFLRVIGGLLALAAVFQIISLVIYPVKYTQTFTLHANPAVTYIYNWAYGFGWAATIILIGCAFFFCCLPNYEDDLLGNAKPRYFYTSA
Construction	1-193 aa
Protein Purity	> 85% as determined by SDS-PAGE.
Molecular Weight	41.4 kDa (predicted)
Endotoxin	< 1.0 EU/μg of the protein as determined by the LAL method.
Formulation	Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Reconstitution	A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Stability & Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
Shipping	In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Research Background	Component of intercellular desmosome junctions. Plays a role in stratified epithelial integrity and cell-cell adhesion by promoting desmosome assembly. Plays a role as an effector in the TP53-dependent apoptotic pathway.

Dose Conversion

You can also refer to dose conversion for different animals. More

Calculator

Reconstitution Calculator
Recombinant Protein Dilution Calculator
Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords

PIGPC 1 KRTCAP 1 KCP-1 KCP 1