GPR182 Protein, Human, Recombinant (His)

Name: GPR182 Protein, Human, Recombinant (His)
Brand: TargetMol
SKU: TMPH-03942
Rating: 4.5 (1 reviews)

(Synonyms: G-protein coupled receptor 182, GPR182, ADMR) Copy Product Info

Synonyms: G-protein coupled receptor 182, GPR182, ADMR

Catalog No. TMPH-03942 Copy Product Info

GPR182 Protein, Human, Recombinant (His) is expressed in in vitro E. coli expression system with N-10xHis. The accession number is O15218.

Customer service consultation

Pack Size	Price	USA Stock	Global Stock
5 μg	$519	20 days	20 days
10 μg	$875	20 days	20 days
20 μg	$1,480	20 days	20 days
50 μg	$1,980	20 days	20 days
100 μg	$2,480	20 days	20 days

For In stock only · Estimated delivery: USA Stock (1-2 days) Global Stock (5-7 days)

Add to Cart

Add to Quotation

For research use only—not for human use. No sales to individuals. Use as intended only.

Questions

Resource Download

User Guide of Recombinant Proteins

Product Introduction

Bioactivity


Description	GPR182 Protein, Human, Recombinant (His) is expressed in in vitro E. coli expression system with N-10xHis. The accession number is O15218.
Species	Human
Expression System	in vitro E. coli expression system
Tag	N-10xHis
Accession Number	O15218
Amino Acid	MSVKPSWGPGPSEGVTAVPTSDLGEIHNWTELLDLFNHTLSECHVELSQSTKRVVLFALYLAMFVVGLVENLLVICVNWRGSGRAGLMNLYILNMAIADLGIVLSLPVWMLEVTLDYTWLWGSFSCRFTHYFYFVNMYSSIFFLVCLSVDRYVTLTSASPSWQRYQHRVRRAMCAGIWVLSAIIPLPEVVHIQLVEGPEPMCLFMAPFETYSTWALAVALSTTILGFLLPFPLITVFNVLTACRLRQPGQPKSRRHCLLLCAYVAVFVMCWLPYHVTLLLLTLHGTHISLHCHLVHLLYFFYDVIDCFSMLHCVINPILYNFLSPHFRGRLLNAVVHYLPKDQTKAGTCASSSSCSTQHSIIITKGDSQPAAAAPHPEPSLSFQAHHLLPNTSPISPTQPLTPS
Construction	1-404 aa
Protein Purity	>85% as determined by SDS-PAGE.
Endotoxin	< 1.0 EU/μg of the protein as determined by the LAL method.
Formulation	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Stability & Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
Shipping	In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Synonyms	G-protein coupled receptor 182, GPR182, ADMR

Chemical Properties

Molecular Weight

46.8 kDa (Predicted)

Storage & Solubility Information

Storage

Lyophilized powder: -20~-80°C for 1 year | Solution: -80°C for 6 months

Calculator

Molarity Calculator
Dilution Calculator
Reconstitution Calculator
Molecular Weight Calculator

Dose Conversion

You can also refer to dose conversion for different animals. More Dose Conversion

Tech Support

Please see Inhibitor Handling Instructions for more frequently ask questions. Topics include: how to prepare stock solutions, how to store products, and cautions on cell-based assays & animal experiments, etc

Keywords

GPR 182

Related Tags: GPR182 Protein, Human, Recombinant (His) chemical structure | GPR182 Protein, Human, Recombinant (His) molecular weight