Your shopping cart is currently empty

GpTx-1 TFA is a polypeptide NaV1.7 sodium channel antagonist isolated from the venom of the Chilean spider Grammostola porter. It exhibits potent inhibitory activity on the NaV1.7 channel with an IC50 value of 10 nM, demonstrating excellent selectivity over NaV1.4 (IC50 = 0.301 μM) and NaV1.5 (IC50 = 4.20 μM) with >20-fold and >950-fold selectivity, respectively.
| Pack Size | Price | USA Stock | Global Stock | Quantity |
|---|---|---|---|---|
| 10 mg | Inquiry | Inquiry | Inquiry | |
| 50 mg | Inquiry | Inquiry | Inquiry |
| Description | GpTx-1 TFA is a polypeptide NaV1.7 sodium channel antagonist isolated from the venom of the Chilean spider Grammostola porter. It exhibits potent inhibitory activity on the NaV1.7 channel with an IC50 value of 10 nM, demonstrating excellent selectivity over NaV1.4 (IC50 = 0.301 μM) and NaV1.5 (IC50 = 4.20 μM) with >20-fold and >950-fold selectivity, respectively. |
| Targets&IC50 | Nav1.3:0.0203 μM |
| Sequence | Asp-Cys-Leu-Gly-Phe-Met-Arg-Lys-Cys-Ile-Pro-Asp-Asn-Asp-Lys-Cys-Cys-Arg-Pro-Asn-Leu-Val-Cys-Ser-Arg-Thr-His-Lys-Trp-Cys-Lys-Tyr-Val-Phe-NH2 (Disulfide bridge: Cys2-Cys17;Cys9-Cys23;Cys16-Cys30) |
| Sequence Short | DCLGFMRKCIPDNDKCCRPNLVCSRTHKWCKYVF (Disulfide bridge: Cys2-Cys17;Cys9-Cys23;Cys16-Cys30) |
| Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |
Dissolve 2 mg of the compound in 100 μL DMSO
to obtain a stock solution at a concentration of 20 mg/mL . If the required concentration exceeds the compound's known solubility, please contact us for technical support before proceeding.
1) Add 100 μL of the DMSO
stock solution to 400 μL PEG300
and mix thoroughly until the solution becomes clear.
2) Add 50 μL Tween 80 and mix well until fully clarified.
3) Add 450 μL Saline,PBS or ddH2O
and mix thoroughly until a homogeneous solution is obtained.
| Size | Quantity | Unit Price | Amount | Operation |
|---|

Copyright © 2015-2026 TargetMol Chemicals Inc. All Rights Reserved.