Shopping Cart
Remove All
Your shopping cart is currently empty
GpTx-1 TFA is a polypeptide NaV1.7 sodium channel antagonist isolated from the venom of the Chilean spider Grammostola porter. It exhibits potent inhibitory activity on the NaV1.7 channel with an IC50 value of 10 nM, demonstrating excellent selectivity over NaV1.4 (IC50 = 0.301 μM) and NaV1.5 (IC50 = 4.20 μM) with >20-fold and >950-fold selectivity, respectively.
| Pack Size | Price | USA Warehouse | Global Warehouse | Quantity |
|---|---|---|---|---|
| 10 mg | Inquiry | Inquiry | Inquiry | |
| 50 mg | Inquiry | Inquiry | Inquiry |
| Description | GpTx-1 TFA is a polypeptide NaV1.7 sodium channel antagonist isolated from the venom of the Chilean spider Grammostola porter. It exhibits potent inhibitory activity on the NaV1.7 channel with an IC50 value of 10 nM, demonstrating excellent selectivity over NaV1.4 (IC50 = 0.301 μM) and NaV1.5 (IC50 = 4.20 μM) with >20-fold and >950-fold selectivity, respectively. |
| Targets&IC50 | Nav1.3:0.0203 μM |
| Sequence | Asp-Cys-Leu-Gly-Phe-Met-Arg-Lys-Cys-Ile-Pro-Asp-Asn-Asp-Lys-Cys-Cys-Arg-Pro-Asn-Leu-Val-Cys-Ser-Arg-Thr-His-Lys-Trp-Cys-Lys-Tyr-Val-Phe-NH2 (Disulfide bridge: Cys2-Cys17;Cys9-Cys23;Cys16-Cys30) |
| Sequence Short | DCLGFMRKCIPDNDKCCRPNLVCSRTHKWCKYVF (Disulfide bridge: Cys2-Cys17;Cys9-Cys23;Cys16-Cys30) |
| Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |
| Size | Quantity | Unit Price | Amount | Operation |
|---|

Copyright © 2015-2026 TargetMol Chemicals Inc. All Rights Reserved.