TRIM51 Protein, Human, Recombinant (His)

Name: TRIM51 Protein, Human, Recombinant (His)
Brand: TargetMol
SKU: TMPH-04547
Rating: 4.5 (1 reviews)

(Synonyms: Tripartite motif-containing protein 51, TRIM51, SPRYD5, SPRY domain-containing protein 5) Copy Product Info

Synonyms: Tripartite motif-containing protein 51, TRIM51, SPRYD5, SPRY domain-containing protein 5

Catalog No. TMPH-04547 Copy Product Info

TRIM51 Protein, Human, Recombinant (His) is expressed in E. coli. The accession number is Q9BSJ1.

Customer service consultation

Pack Size	Price	USA Stock	Global Stock
5 µg	$116	20 days	20 days
10 µg	$189	20 days	20 days
20 µg	$317	20 days	20 days
50 µg	$448	20 days	20 days
100 µg	$588	20 days	20 days
200 µg	$913	20 days	20 days
500 µg	$1,630	20 days	20 days
1 mg	$2,550	20 days	20 days

For In stock only · Estimated delivery: USA Stock (1-2 days) Global Stock (5-7 days)

Add to Cart

Add to Quotation

For research use only—not for human use. No sales to individuals. Use as intended only.

Questions

Resource Download

Bioactivity

Bioactivity	Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description	TRIM51 Protein, Human, Recombinant (His) is expressed in E. coli. The accession number is Q9BSJ1.
Species	Human
Expression System	E. coli
Tag	C-6xHis
Accession Number	Q9BSJ1
Amino Acid	MNSGILQVFQRALTCPICMNYFLDPVTIDCGHSFCRPCLYLNWQDTAVLAQCSECKKTTRQRNLNTDICLKNMAFIARKASLRQFLSSEEQICGMHRETKKMFCEVDKSLLCLPCSNSQEHRNHIHCPIEWAAEERREELLKKMQSLWEKACENLRNLNMETTRTRCWKDYVSLRIEAIRAEYQKMPAFLHEEEQHHLERLRKEGEDIFQQLNESKARMEHSRELLRGMYEDLKQMCHKADVELLQAFGDILHRYESLLLQVSEPVNPELSAGPITGLLDSLSGFRVDFTLQPERANSHIFLCGDLRSMNVGCDPQDDPDITGKSECFLVWGAQAFTSGKYYWEVHMGDSWNWAFGVCNNYWKEKRQNDKIDGEEGLFLLGCVKEDTHCSLFTTSPLVVQYVPRPTSTVGLFLDCEGRTVSFVDVDQSSLIYTIPNCSFSPPLRPIFCCSHF
Construction	1-452 aa
Protein Purity	> 90% as determined by SDS-PAGE.
Endotoxin	Not tested.
Formulation	Lyophilized from PBS, 6% Trehalose, pH 7.4
Reconstitution	Reconstitute the lyophilized protein in distilled water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Synonyms	Tripartite motif-containing protein 51, TRIM51, SPRYD5, SPRY domain-containing protein 5

Chemical Properties

Molecular Weight

53.4 kDa (Predicted)

Storage & Solubility Information

Shipping	In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 184 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.