Shopping Cart
Remove All
  • TargetMol
    Your shopping cart is currently empty

DNA-binding protein H-NS Protein, SerRatia marcescens, Recombinant (His)

TargetMol | SPR Buffer-Exchangeable
Catalog No. TMPH-03487 Copy Product Info
A DNA-binding protein implicated in transcriptional repression and chromosome organization and compaction. Binds nucleation sites in AT-rich DNA and bridges them, forming higher-order nucleoprotein complexes and condensing the chromosome. As many horizontally transferred genes are AT-rich, it plays a central role in silencing foreign genes. A subset of genes are repressed by H-NS in association with other proteins. DNA-binding protein H-NS Protein, SerRatia marcescens, Recombinant (His) is expressed in E. coli expression system with N-6xHis tag. The predicted molecular weight is 19.5 kDa and the accession number is P18955.

DNA-binding protein H-NS Protein, SerRatia marcescens, Recombinant (His)

Catalog No. TMPH-03487
Copy Product Info
TargetMol | SPR Buffer-Exchangeable

A DNA-binding protein implicated in transcriptional repression and chromosome organization and compaction. Binds nucleation sites in AT-rich DNA and bridges them, forming higher-order nucleoprotein complexes and condensing the chromosome. As many horizontally transferred genes are AT-rich, it plays a central role in silencing foreign genes. A subset of genes are repressed by H-NS in association with other proteins. DNA-binding protein H-NS Protein, SerRatia marcescens, Recombinant (His) is expressed in E. coli expression system with N-6xHis tag. The predicted molecular weight is 19.5 kDa and the accession number is P18955.

DNA-binding protein H-NS Protein, SerRatia marcescens, Recombinant (His)
Pack SizePriceUSA StockGlobal StockQuantity
5 μg$12920 days20 days
10 μg$21620 days20 days
20 μg$36020 days20 days
50 μg$54320 days20 days
100 μg$74520 days20 days
200 μg$1,07020 days20 days
500 μg$1,73020 days20 days
1 mg$2,53020 days20 days
Add to Cart
Add to Quotation
For In stock only · Estimated delivery:USA Stock (1-2 days) Global Stock (5-7 days)
For research use only—not for human use. No sales to individuals. Use as intended only.
Questions
View More

Batch Information

Product Information

Biological Activity
Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description
A DNA-binding protein implicated in transcriptional repression and chromosome organization and compaction. Binds nucleation sites in AT-rich DNA and bridges them, forming higher-order nucleoprotein complexes and condensing the chromosome. As many horizontally transferred genes are AT-rich, it plays a central role in silencing foreign genes. A subset of genes are repressed by H-NS in association with other proteins. DNA-binding protein H-NS Protein, SerRatia marcescens, Recombinant (His) is expressed in E. coli expression system with N-6xHis tag. The predicted molecular weight is 19.5 kDa and the accession number is P18955.
Species
Serratia marcescens
Expression System
E. coli
TagN-6xHis
Accession NumberP18955
Synonyms
hnsA,hns,Histone-like protein HLP-II,DNA-binding protein H-NS
Amino Acid
SERLKILNNIRTLRAQARECTLETLEEMLEKLEVVVNERREEDSQAQAEIEERTRKLQQYREMLIADGIDPNELLQTMAANKAAGKAKRARRPAKYQYKDENGELKTWTGQGRTPAVIKKAIEEQGKSLDDFLL
Construction
2-135 aa
Protein Purity
> 90% as determined by SDS-PAGE.
Molecular Weight19.5 kDa (predicted)
Endotoxin< 1.0 EU/μg of the protein as determined by the LAL method.
FormulationTris-based buffer, 50% glycerol
Reconstitution
A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Research Background
A DNA-binding protein implicated in transcriptional repression and chromosome organization and compaction. Binds nucleation sites in AT-rich DNA and bridges them, forming higher-order nucleoprotein complexes and condensing the chromosome. As many horizontally transferred genes are AT-rich, it plays a central role in silencing foreign genes. A subset of genes are repressed by H-NS in association with other proteins.

Citations

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Dose Conversion

You can also refer to dose conversion for different animals. More

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.