GPD2 Protein, Candida albicans, Recombinant (His)

Catalog No. TMPH-00336 Copy Product Info

GPD2 Protein, Candida albicans, Recombinant (His) is expressed in yeast with C-6xHis tag. The predicted molecular weight is 42.3 kDa and the accession number is Q59W33.

GPD2 Protein, Candida albicans, Recombinant (His)

Catalog No. TMPH-00336

Copy Product Info

GPD2 Protein, Candida albicans, Recombinant (His) is expressed in yeast with C-6xHis tag. The predicted molecular weight is 42.3 kDa and the accession number is Q59W33.

Pack Size	Price	USA Stock	Global Stock
5 μg	$125	-	In Stock
10 μg	$198	-	In Stock
20 μg	$341	-	In Stock
50 μg	$497	-	In Stock
100 μg	$696	20 days	20 days
200 μg	$1,070	20 days	20 days
500 μg	$1,890	20 days	20 days
1 mg	$2,970	20 days	20 days

Add to Cart

Add to Quotation

For In stock only · Estimated delivery:USA Stock (1-2 days) Global Stock (5-7 days)

For research use only—not for human use. No sales to individuals. Use as intended only.

Questions

Batch Information

Select Batch

Resource Download

COA User Guide of Recombinant Proteins

Product Information

Biological Activity	Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description	GPD2 Protein, Candida albicans, Recombinant (His) is expressed in yeast with C-6xHis tag. The predicted molecular weight is 42.3 kDa and the accession number is Q59W33.
Species	Candida albicans
Expression System	P. pastoris (Yeast)
Tag	C-6xHis
Accession Number	Q59W33
Synonyms	GPD2,Glycerol-3-phosphate dehydrogenase [NAD(+)] 2
Amino Acid	MTTSPYPIETPFKVCIVGSGNWGTAVAKLVAENCAEKPNIFQRDVKMWVFEEEIEGRKLTEIINTEHENVKYLPEIKLPTNLVANPDIVDTVQDADLIVFNIPHQFLGRIVKQIEGKVKPTARAISCLKGLDVSPEGCKLLSTSITDTLKIYCGVLSGANIANEVAKGNWSETSIAYTVPEDFRGAGKDIDPFILKEAFHRPYFHVRVIEDVVGASIAGALKNVIACSVGFVEGAGWGDNAKAAIMRIGIKETIRFASYWELFKIKALSPPNPKTFTEESAGVADLITTCSGGRNVKVARYMIKNNVDAFEAEKIVLKGQSSQGILTAKEVHELLTNFNLQDEFPLLEATYKVIYENGSVDDFPQLLEGDQ
Construction	1-371 aa
Protein Purity	> 85% as determined by SDS-PAGE.
Molecular Weight	42.3 kDa (predicted)
Endotoxin	< 1.0 EU/μg of the protein as determined by the LAL method.
Formulation	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/mL. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Stability & Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
Shipping	In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.