Shopping Cart
Remove All
  • TargetMol
    Your shopping cart is currently empty

RAB33A Protein, Human, Recombinant (His)

TargetMol | SPR Buffer-Exchangeable
Catalog No. TMPH-04102 Copy Product Info
RAB33A Protein, Human, Recombinant (His) is expressed in HEK293 Cells with C-10xHis. The accession number is Q14088.

RAB33A Protein, Human, Recombinant (His)

Catalog No. TMPH-04102
Copy Product Info
TargetMol | SPR Buffer-Exchangeable

RAB33A Protein, Human, Recombinant (His) is expressed in HEK293 Cells with C-10xHis. The accession number is Q14088.

RAB33A Protein, Human, Recombinant (His)
Pack SizePriceUSA StockGlobal StockQuantity
5 μg$13320 days20 days
10 μg$21920 days20 days
20 μg$36820 days20 days
50 μg$64320 days20 days
100 μg$98720 days20 days
200 μg$1,53020 days20 days
500 μg$2,77020 days20 days
1 mg$4,33020 days20 days
Add to Cart
Add to Quotation
In stock · Estimated delivery: USA Stock (1-2 days) Global Stock (5-7 days)
For research use only—not for human use. No sales to individuals. Use as intended only.
Questions
View More

Batch Information

Product Information

Biological Activity
Activity has not been tested. It is theoretically active, but we cannot guarantee it.
Description
RAB33A Protein, Human, Recombinant (His) is expressed in HEK293 Cells with C-10xHis. The accession number is Q14088.
Species
Human
Expression System
HEK293 Cells
TagC-10xHis
Accession NumberQ14088
Synonyms
Small GTP-binding protein S10,Ras-related protein Rab-33A,RABS10,RAB33A
Amino Acid
MAQPILGHGSLQPASAAGLASLELDSSLDQYVQIRIFKIIVIGDSNVGKTCLTFRFCGGTFPDKTEATIGVDFREKTVEIEGEKIKVQVWDTAGQERFRKSMVEHYYRNVHAVVFVYDVTKMTSFTNLKMWIQECNGHAVPPLVPKVLVGNKCDLREQIQVPSNLALKFADAHNMLLFETSAKDPKESQNVESIFMCLACRLKAQKSLLYRDAERQQGKVQKLEFPQEANSKTSCPC
Construction
1-237 aa
Protein Purity
>85% as determined by SDS-PAGE.
Molecular Weight28.0 kDa (Predicted)
Endotoxin< 1.0 EU/μg of the protein as determined by the LAL method.
FormulationIf the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.

Dose Conversion

You can also refer to dose conversion for different animals. More

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords