RAB33A Protein, Human, Recombinant (His)

Name: RAB33A Protein, Human, Recombinant (His)
Brand: TargetMol
SKU: TMPH-04102
Rating: 4.5 (1 reviews)

(Synonyms: Small GTP-binding protein S10, Ras-related protein Rab-33A, RABS10, RAB33A) Copy Product Info

Synonyms: Small GTP-binding protein S10, Ras-related protein Rab-33A, RABS10, RAB33A

Catalog No. TMPH-04102 Copy Product Info

RAB33A Protein, Human, Recombinant (His) is expressed in HEK293 Cells with C-10xHis. The accession number is Q14088.

Customer service consultation

Pack Size	Price	USA Stock	Global Stock
5 μg	$133	20 days	20 days
10 μg	$219	20 days	20 days
20 μg	$368	20 days	20 days
50 μg	$643	20 days	20 days
100 μg	$987	20 days	20 days
200 μg	$1,530	20 days	20 days
500 μg	$2,770	20 days	20 days
1 mg	$4,330	20 days	20 days

For In stock only · Estimated delivery: USA Stock (1-2 days) Global Stock (5-7 days)

Add to Cart

Add to Quotation

For research use only—not for human use. No sales to individuals. Use as intended only.

Questions

Resource Download

User Guide of Recombinant Proteins

Product Introduction

Bioactivity

Bioactivity
Description	RAB33A Protein, Human, Recombinant (His) is expressed in HEK293 Cells with C-10xHis. The accession number is Q14088.
Species	Human
Expression System	HEK293 Cells
Tag	C-10xHis
Accession Number	Q14088
Amino Acid	MAQPILGHGSLQPASAAGLASLELDSSLDQYVQIRIFKIIVIGDSNVGKTCLTFRFCGGTFPDKTEATIGVDFREKTVEIEGEKIKVQVWDTAGQERFRKSMVEHYYRNVHAVVFVYDVTKMTSFTNLKMWIQECNGHAVPPLVPKVLVGNKCDLREQIQVPSNLALKFADAHNMLLFETSAKDPKESQNVESIFMCLACRLKAQKSLLYRDAERQQGKVQKLEFPQEANSKTSCPC
Construction	1-237 aa
Protein Purity	>85% as determined by SDS-PAGE.
Endotoxin	< 1.0 EU/μg of the protein as determined by the LAL method.
Formulation	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Stability & Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
Shipping	In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Synonyms	Small GTP-binding protein S10, Ras-related protein Rab-33A, RABS10, RAB33A

Chemical Properties

Molecular Weight

28.0 kDa (Predicted)

Storage & Solubility Information

Storage

Lyophilized powder: -20~-80°C for 1 year | Solution: -80°C for 6 months Shipping with blue ice/Shipping at ambient temperature.

Calculator

Molarity Calculator
Dilution Calculator
Reconstitution Calculator
Molecular Weight Calculator

Dose Conversion

You can also refer to dose conversion for different animals. More Dose Conversion

Tech Support

Please see Inhibitor Handling Instructions for more frequently ask questions. Topics include: how to prepare stock solutions, how to store products, and cautions on cell-based assays & animal experiments, etc

Keywords

RABS 10

Related Tags: RAB33A Protein, Human, Recombinant (His) chemical structure | RAB33A Protein, Human, Recombinant (His) molecular weight