SRRM2 Protein, Human, Recombinant (His & Myc)

(Synonyms: Tax-responsive enhancer element-binding protein 803 (TaxREB803), SRRM2, SRM300, SRL300, Splicing coactivator subunit SRm300, Serine/arginine-rich splicing factor-related nuclear matrix protein of 300 kDa (SR-related nuclear matrix protein of 300 kDa;Ser/Arg-related nuclear matrix protein of 300 kDa), Serine/arginine repetitive matrix protein 2, KIAA0324, 300 kDa nuclear matrix antigen) Copy Product Info

Synonyms: Tax-responsive enhancer element-binding protein 803 (TaxREB803), SRRM2, SRM300, SRL300, Splicing coactivator subunit SRm300, Serine/arginine-rich splicing factor-related nuclear matrix protein of 300 kDa (SR-related nuclear matrix protein of 300 kDa;Ser/Arg-related nuclear matrix protein of 300 kDa), Serine/arginine repetitive matrix protein 2, KIAA0324, 300 kDa nuclear matrix antigen

Catalog No. TMPH-02084 Copy Product Info

SRRM2 Protein, Human, Recombinant (His & Myc) is expressed in Baculovirus.

Customer service consultation

Pack Size	Price	USA Stock	Global Stock
5 µg	$176	20 days	20 days
10 µg	$293	20 days	20 days
20 µg	$491	20 days	20 days
50 µg	$926	20 days	20 days
100 µg	$1,500	20 days	20 days
200 µg	$1,830	20 days	20 days
500 µg	$2,390	20 days	20 days
1 mg	$2,960	20 days	20 days

For In stock only · Estimated delivery: USA Stock (1-2 days) Global Stock (5-7 days)

Add to Cart

Add to Quotation

For research use only—not for human use. No sales to individuals. Use as intended only.

Questions

Resource Download

User Guide of Recombinant Proteins

Product Introduction

Bioactivity

Bioactivity	Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description	SRRM2 Protein, Human, Recombinant (His & Myc) is expressed in Baculovirus.
Species	Human
Expression System	Baculovirus Insect Cells
Tag	N-10xHis, C-Myc
Accession Number	Q9UQ35
Amino Acid	RTARRGSRSSPEPKTKSRTPPRRRSSRSSPELTRKARLSRRSRSASSSPETRSRTPPRHRRSPSVSSPEPAEKSRSSRRRRSASSPRTKTTSRRGRSPSPKPRGLQRSRSRSRREKTRTTRRRDRSGSSQSTSRRRQRSRSRSRVTRRRRGGSGYHSRSPARQESSRTSSRRRRGRSRTPPTSRKRSRSRTSPAPWKRSRSRASPATHRRSRSRTPLISRRRSRSRTSPVSRRRSRSRTSVTRRRSRSRASPVSRRRSRSRTPPVTRRRSRSRTPTTRRRSRSRTPPVTRRRSRSRTPPVTRRRSRSRTSPITRRRSRSRTSPVTRRRSRSRTSPVTRRRSRSRTSPVTRRRSRSRTPPAIRRRSRSRTPLLPRKRSRSRSPLAIRRRSRSRTPRTARGKRSLTRSPPAIRRRSASGSSSDRSR
Construction	1666-2089 aa
Protein Purity	> 85% as determined by SDS-PAGE.
Endotoxin	< 1.0 EU/μg of the protein as determined by the LAL method.
Formulation	Tris-based buffer, 50% glycerol
Reconstitution	A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Synonyms	Tax-responsive enhancer element-binding protein 803 (TaxREB803), SRRM2, SRM300, SRL300, Splicing coactivator subunit SRm300, Serine/arginine-rich splicing factor-related nuclear matrix protein of 300 kDa (SR-related nuclear matrix protein of 300 kDa;Ser/Arg-related nuclear matrix protein of 300 kDa), Serine/arginine repetitive matrix protein 2, KIAA0324, 300 kDa nuclear matrix antigen
Research Background	Required for pre-mRNA splicing as component of the spliceosome.

Chemical Properties

Molecular Weight

53.8 kDa (predicted)

Storage & Solubility Information

Shipping	In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.