MT1G Protein, Human, Recombinant (GST)

Name: MT1G Protein, Human, Recombinant (GST)
Brand: TargetMol
SKU: TMPH-01666
Rating: 4.5 (1 reviews)

(Synonyms: MT1M, MT1K, MT-1G, MT1G, Metallothionein-IG (MT-IG), Metallothionein-1K (MT-1K), Metallothionein-1G) Copy Product Info

Synonyms: MT1M, MT1K, MT-1G, MT1G, Metallothionein-IG (MT-IG), Metallothionein-1K (MT-1K), Metallothionein-1G

Catalog No. TMPH-01666 Copy Product Info

Metallothioneins have a high content of cysteine residues that bind various heavy metals; these proteins are transcriptionally regulated by both heavy metals and glucocorticoids. MT1G Protein, Human, Recombinant (GST) is expressed in E. coli expression system with N-GST tag. The predicted molecular weight is 32.9 kDa and the accession number is P13640.

Customer service consultation

Pack Size	Price	USA Stock	Global Stock
5 µg	$75	20 days	20 days
10 µg	$119	20 days	20 days
20 µg	$198	20 days	20 days
50 µg	$297	20 days	20 days
100 µg	$427	20 days	20 days
200 µg	$658	20 days	20 days
500 µg	$1,170	20 days	20 days
1 mg	$1,830	20 days	20 days

For In stock only · Estimated delivery: USA Stock (1-2 days) Global Stock (5-7 days)

Add to Cart

Add to Quotation

For research use only—not for human use. No sales to individuals. Use as intended only.

Questions

Resource Download

User Guide of Recombinant Proteins

Product Introduction

Bioactivity

Bioactivity	Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description	Metallothioneins have a high content of cysteine residues that bind various heavy metals; these proteins are transcriptionally regulated by both heavy metals and glucocorticoids. MT1G Protein, Human, Recombinant (GST) is expressed in E. coli expression system with N-GST tag. The predicted molecular weight is 32.9 kDa and the accession number is P13640.
Species	Human
Expression System	E. coli
Tag	N-GST
Accession Number	P13640
Amino Acid	MDPNCSCAAGVSCTCASSCKCKECKCTSCKKSCCSCCPVGCAKCAQGCICKGASEKCSC
Construction	1-59 aa
Protein Purity	> 90% as determined by SDS-PAGE.
Endotoxin	< 1.0 EU/μg of the protein as determined by the LAL method.
Formulation	Tris-based buffer, 50% glycerol
Reconstitution	A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Synonyms	MT1M, MT1K, MT-1G, MT1G, Metallothionein-IG (MT-IG), Metallothionein-1K (MT-1K), Metallothionein-1G
Research Background	Metallothioneins have a high content of cysteine residues that bind various heavy metals; these proteins are transcriptionally regulated by both heavy metals and glucocorticoids.

Chemical Properties

Molecular Weight

32.9 kDa (predicted)

Storage & Solubility Information

Shipping	In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.