Shopping Cart
- Remove All
- Your shopping cart is currently empty
FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is an Exendin-4 peptide derivative.Exendin-4 peptide derivatives are structurally derived from Exendin-4 and may relates to dual GLP-1/glucagon receptor agonists.
Pack Size | Price | Availability | Quantity |
---|---|---|---|
1 mg | $274 | Backorder | |
5 mg | $981 | Backorder | |
10 mg | $1,485 | Backorder |
Description | FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is an Exendin-4 peptide derivative.Exendin-4 peptide derivatives are structurally derived from Exendin-4 and may relates to dual GLP-1/glucagon receptor agonists. |
Synonyms | FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS |
Molecular Weight | 3692.15 |
Formula | NA |
Relative Density. | no data available |
Sequence | H-DL-His-Gly-DL-Glu-Gly-DL-xiThr-DL-Phe-DL-xiThr-DL-Ser-DL-Asp-DL-Leu-DL-Ser-DL-Lys-DL-Gln-DL-Met-DL-Glu-DL-Glu-DL-Glu-DL-Ala-DL-Val-DL-Arg-DL-Leu-DL-Phe-DL-xiIle-DL-Glu-DL-Trp-DL-Leu-DL-Lys-DL-Asn-Gly-Gly-DL-Pro-DL-Ser-DL-Ser-Gly-DL-Ala-DL-Pro-DL-Pro-DL- |
Sequence Short | HGEGXFXSDLSKQMEEEAVRLFXEWLKNGGPSSGAPPPS |
Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice. |
Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.