Shopping Cart
Remove All
Your shopping cart is currently empty
Synonyms: KIAA1754L, ITPRIPL1, Inositol 1,4,5-trisphosphate receptor-interacting protein-like 1, 5-trisphosphate receptor-interacting protein-like 1, 4


| Pack Size | Price | USA Stock | Global Stock | Quantity |
|---|---|---|---|---|
| 5 µg | $50 | 20 days | 20 days | |
| 10 µg | $79 | 20 days | 20 days | |
| 20 µg | $127 | 20 days | 20 days | |
| 50 µg | $213 | 20 days | 20 days | |
| 100 µg | $319 | 20 days | 20 days | |
| 200 µg | $558 | 20 days | 20 days | |
| 500 µg | $1,170 | 20 days | 20 days | |
| 1 mg | $2,080 | 20 days | 20 days |
| Bioactivity | Measured by its binding ability in a functional ELISA. Immobilized Human ITPRIPL1 at 2 μg/mL can bind Anti-ITPRIPL1 recombinant antibody (CSB-RA756966MA1HU). The EC50 is 6.537-7.663 ng/mL. |
| Description | ITPRIPL1 Protein, Human, Recombinant (Active, His) is expressed in HEK293 Cells with C-10xHis. The accession number is Q6GPH6. |
| Species | Human |
| Expression System | HEK293 Cells |
| Tag | C-10xHis |
| Accession Number | Q6GPH6 |
| Amino Acid | HPLMVSDRMDLDTLARSRQLEKRMSEEMRLLEMEFEERKRAAEQRQKAENFWTGDTSSDQLVLGKKDMGWPFQADGQEG |
| Construction | 25-103 aa |
| Protein Purity | >95% as determined by SDS-PAGE. |
| Endotoxin | < 1.0 EU/μg of the protein as determined by the LAL method. |
| Formulation | Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4 |
| Reconstitution | Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing. |
| Synonyms | KIAA1754L, ITPRIPL1, Inositol 1,4,5-trisphosphate receptor-interacting protein-like 1, 5-trisphosphate receptor-interacting protein-like 1, 4 |
| Molecular Weight | 10.7 kDa (Predicted) |
| Shipping | In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice. |
| Storage | Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
| Size | Quantity | Unit Price | Amount | Operation |
|---|

Copyright © 2015-2026 TargetMol Chemicals Inc. All Rights Reserved.