Shopping Cart
  • Remove All
  • TargetMol
    Your shopping cart is currently empty

ITPRIPL1 Protein, Human, Recombinant (Active, His)

Catalog No. TMPH-03977

ITPRIPL1 Protein, Human, Recombinant (Active, His) is expressed in HEK293 Cells with C-10xHis. The accession number is Q6GPH6.

ITPRIPL1 Protein, Human, Recombinant (Active, His)

ITPRIPL1 Protein, Human, Recombinant (Active, His)

Catalog No. TMPH-03977
ITPRIPL1 Protein, Human, Recombinant (Active, His) is expressed in HEK293 Cells with C-10xHis. The accession number is Q6GPH6.
Pack SizePriceAvailabilityQuantity
20 μg $12720 days
100 μg $31920 days
1 mg $2,08020 days
Bulk & Custom
Add to Cart
Questions
View More
All TargetMol products are for research purposes only and cannot be used for human consumption. We do not provide products or services to individuals. Please comply with the intended use and do not use TargetMol products for any other purpose.

Product Information

Biological Activity
Measured by its binding ability in a functional ELISA. Immobilized Human ITPRIPL1 at 2 μg/mL can bind Anti-ITPRIPL1 recombinant antibody (CSB-RA756966MA1HU). The EC50 is 6.537-7.663 ng/mL.
Description
ITPRIPL1 Protein, Human, Recombinant (Active, His) is expressed in HEK293 Cells with C-10xHis. The accession number is Q6GPH6.
Species
Human
Expression System
HEK293 Cells
TagC-10xHis
Accession NumberQ6GPH6
Synonyms
KIAA1754L,ITPRIPL1,Inositol 1,4,5-trisphosphate receptor-interacting protein-like 1,5-trisphosphate receptor-interacting protein-like 1,4
Amino Acid
HPLMVSDRMDLDTLARSRQLEKRMSEEMRLLEMEFEERKRAAEQRQKAENFWTGDTSSDQLVLGKKDMGWPFQADGQEG
Construction
25-103 aa
Protein Purity
>95% as determined by SDS-PAGE.
Molecular Weight10.7 kDa (Predicted)
Endotoxin< 1.0 EU/μg of the protein as determined by the LAL method.
FormulationLyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4
Reconstitution
Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice.

Dose Conversion

You can also refer to dose conversion for different animals. More

Sci Citations

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords