ITPRIPL1 Protein, Human, Recombinant (Active, His)

Name: ITPRIPL1 Protein, Human, Recombinant (Active, His)
Brand: TargetMol
SKU: TMPH-03977
Rating: 4.5 (1 reviews)

(Synonyms: KIAA1754L, ITPRIPL1, Inositol 1,4,5-trisphosphate receptor-interacting protein-like 1, 5-trisphosphate receptor-interacting protein-like 1, 4) Copy Product Info

Synonyms: KIAA1754L, ITPRIPL1, Inositol 1,4,5-trisphosphate receptor-interacting protein-like 1, 5-trisphosphate receptor-interacting protein-like 1, 4

Catalog No. TMPH-03977 Copy Product Info

ITPRIPL1 Protein, Human, Recombinant (Active, His) is expressed in HEK293 Cells with C-10xHis. The accession number is Q6GPH6.

Customer service consultation

Pack Size	Price	USA Stock	Global Stock
5 µg	$50	20 days	20 days
10 µg	$79	20 days	20 days
20 µg	$127	20 days	20 days
50 µg	$213	20 days	20 days
100 µg	$319	20 days	20 days
200 µg	$558	20 days	20 days
500 µg	$1,170	20 days	20 days
1 mg	$2,080	20 days	20 days

For In stock only · Estimated delivery: USA Stock (1-2 days) Global Stock (5-7 days)

Add to Cart

Add to Quotation

For research use only—not for human use. No sales to individuals. Use as intended only.

Questions

Resource Download

User Guide of Recombinant Proteins

Product Introduction

Bioactivity

Bioactivity	Measured by its binding ability in a functional ELISA. Immobilized Human ITPRIPL1 at 2 μg/mL can bind Anti-ITPRIPL1 recombinant antibody (CSB-RA756966MA1HU). The EC50 is 6.537-7.663 ng/mL.
Description	ITPRIPL1 Protein, Human, Recombinant (Active, His) is expressed in HEK293 Cells with C-10xHis. The accession number is Q6GPH6.
Species	Human
Expression System	HEK293 Cells
Tag	C-10xHis
Accession Number	Q6GPH6
Amino Acid	HPLMVSDRMDLDTLARSRQLEKRMSEEMRLLEMEFEERKRAAEQRQKAENFWTGDTSSDQLVLGKKDMGWPFQADGQEG
Construction	25-103 aa
Protein Purity	>95% as determined by SDS-PAGE.
Endotoxin	< 1.0 EU/μg of the protein as determined by the LAL method.
Formulation	Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4
Reconstitution	Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Synonyms	KIAA1754L, ITPRIPL1, Inositol 1,4,5-trisphosphate receptor-interacting protein-like 1, 5-trisphosphate receptor-interacting protein-like 1, 4

Chemical Properties

Molecular Weight

10.7 kDa (Predicted)

Storage & Solubility Information

Shipping	In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.

Calculator

Reconstitution Calculator
Recombinant Protein Dilution Calculator
Specific Activity Calculator

Dose Conversion

You can also refer to dose conversion for different animals. More Dose Conversion

Tech Support

Please see Recombinant Proteins

Keywords

ITPRIPL 1

Related Tags: ITPRIPL1 Protein, Human, Recombinant (Active, His) chemical structure | ITPRIPL1 Protein, Human, Recombinant (Active, His) molecular weight