Shopping Cart
Remove All
  • TargetMol
    Your shopping cart is currently empty

ITPRIPL1 Protein, Human, Recombinant (Active, His)

TargetMol | SPR Buffer-Exchangeable
Catalog No. TMPH-03977 Copy Product Info
ITPRIPL1 Protein, Human, Recombinant (Active, His) is expressed in HEK293 Cells with C-10xHis. The accession number is Q6GPH6.

ITPRIPL1 Protein, Human, Recombinant (Active, His)

Catalog No. TMPH-03977
Copy Product Info
TargetMol | SPR Buffer-Exchangeable

ITPRIPL1 Protein, Human, Recombinant (Active, His) is expressed in HEK293 Cells with C-10xHis. The accession number is Q6GPH6.

ITPRIPL1 Protein, Human, Recombinant (Active, His)
Pack SizePriceUSA StockGlobal StockQuantity
5 μg$5020 days20 days
10 μg$7920 days20 days
20 μg$12720 days20 days
50 μg$21320 days20 days
100 μg$31920 days20 days
200 μg$55820 days20 days
500 μg$1,17020 days20 days
1 mg$2,08020 days20 days
Add to Cart
Add to Quotation
For In stock only · Estimated delivery:USA Stock (1-2 days) Global Stock (5-7 days)
For research use only—not for human use. No sales to individuals. Use as intended only.
Questions
View More

Batch Information

Product Information

Biological Activity
Measured by its binding ability in a functional ELISA. Immobilized Human ITPRIPL1 at 2 μg/mL can bind Anti-ITPRIPL1 recombinant antibody (CSB-RA756966MA1HU). The EC50 is 6.537-7.663 ng/mL.
Description
ITPRIPL1 Protein, Human, Recombinant (Active, His) is expressed in HEK293 Cells with C-10xHis. The accession number is Q6GPH6.
Species
Human
Expression System
HEK293 Cells
TagC-10xHis
Accession NumberQ6GPH6
Synonyms
KIAA1754L,ITPRIPL1,Inositol 1,4,5-trisphosphate receptor-interacting protein-like 1,5-trisphosphate receptor-interacting protein-like 1,4
Amino Acid
HPLMVSDRMDLDTLARSRQLEKRMSEEMRLLEMEFEERKRAAEQRQKAENFWTGDTSSDQLVLGKKDMGWPFQADGQEG
Construction
25-103 aa
Protein Purity
>95% as determined by SDS-PAGE.
Molecular Weight10.7 kDa (Predicted)
Endotoxin< 1.0 EU/μg of the protein as determined by the LAL method.
FormulationLyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4
Reconstitution
Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.

Dose Conversion

You can also refer to dose conversion for different animals. More

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords