Shopping Cart
  • Remove All
  • TargetMol
    Your shopping cart is currently empty

EGLN3 Protein, Human, Recombinant (His)

Catalog No. TMPH-03906

EGLN3 Protein, Human, Recombinant (His) is expressed in E. coli with C-6xHis. The accession number is Q9H6Z9.

EGLN3 Protein, Human, Recombinant (His)

EGLN3 Protein, Human, Recombinant (His)

Catalog No. TMPH-03906
EGLN3 Protein, Human, Recombinant (His) is expressed in E. coli with C-6xHis. The accession number is Q9H6Z9.
Pack SizePriceAvailabilityQuantity
20 μg $28320 days
100 μg $53720 days
1 mg $2,30020 days
Bulk & Custom
Add to Cart
Questions
View More
All TargetMol products are for research purposes only and cannot be used for human consumption. We do not provide products or services to individuals. Please comply with the intended use and do not use TargetMol products for any other purpose.

Product Information

Biological Activity
Activity has not been tested. It is theoretically active, but we cannot guarantee it.
Description
EGLN3 Protein, Human, Recombinant (His) is expressed in E. coli with C-6xHis. The accession number is Q9H6Z9.
Species
Human
Expression System
E. coli
TagC-6xHis
Accession NumberQ9H6Z9
Synonyms
Prolyl hydroxylase EGLN3,Prolyl hydroxylase domain-containing protein 3 (PHD3),Hypoxia-inducible factor prolyl hydroxylase 3 (HIF-PH3;HIF-prolyl hydroxylase 3;HPH-3),HPH-1,EGLN3,Egl nine homolog 3
Amino Acid
MPLGHIMRLDLEKIALEYIVPCLHEVGFCYLDNFLGEVVGDCVLERVKQLHCTGALRDGQLAGPRAGVSKRHLRGDQITWIGGNEEGCEAISFLLSLIDRLVLYCGSRLGKYYVKERSKAMVACYPGNGTGYVRHVDNPNGDGRCITCIYYLNKNWDAKLHGGILRIFPEGKSFIADVEPIFDRLLFFWSDRRNPHEVQPSYATRYAMTVWYFDAEERAEAKKKFRNLTRKTESALTED
Construction
1-239 aa
Protein Purity
>85% as determined by SDS-PAGE.
Molecular Weight34.1 kDa (Predicted)
Endotoxin< 1.0 EU/μg of the protein as determined by the LAL method.
FormulationIf the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice.

Dose Conversion

You can also refer to dose conversion for different animals. More

Sci Citations

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords