Shopping Cart
Remove All
  • TargetMol
    Your shopping cart is currently empty

STRA6 Protein, Human, Recombinant (hFc)

Copy Product Info
TargetMol | SPR Buffer-Exchangeable
Catalog No. TMPH-02006

STRA6 Protein, Human, Recombinant (hFc) is expressed in HEK293.

STRA6 Protein, Human, Recombinant (hFc)

STRA6 Protein, Human, Recombinant (hFc)

Copy Product Info
TargetMol | SPR Buffer-Exchangeable
Catalog No. TMPH-02006
STRA6 Protein, Human, Recombinant (hFc) is expressed in HEK293.
Pack SizePriceUSA WarehouseGlobal WarehouseQuantity
5 μg$21920 days20 days
10 μg$36520 days20 days
20 μg$61320 days20 days
50 μg$1,16020 days20 days
100 μg$1,89020 days20 days
200 μg$2,89020 days20 days
500 μg$5,16020 days20 days
1 mg$7,96020 days20 days
Add to Cart
Add to Quotation
In Stock Estimated shipping dateUSA Warehouse [1-2 days] Global Warehouse [5-7 days]
All TargetMol products are for research purposes only and cannot be used for human consumption. We do not provide products or services to individuals. Please comply with the intended use and do not use TargetMol products for any other purpose.
Questions
View More
Select Batch

Product Information

Biological Activity
Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description
STRA6 Protein, Human, Recombinant (hFc) is expressed in HEK293.
Species
Human
Expression System
HEK293 Cells
TagC-hFc
Accession NumberQ9BX79
Synonyms
STRA6,Stimulated by retinoic acid gene 6 protein homolog,Retinol-binding protein receptor STRA6,Receptor for retinol uptake STRA6
Amino Acid
MSSQPAGNQTSPGATEDYSYGSWYIDEPQGGEELQPEGEVPSCHTSIPPG
Construction
1-50 aa
Protein Purity
> 85% as determined by SDS-PAGE.
STRA6 Protein, Human, Recombinant (hFc)
Molecular Weight34.2 kDa (predicted)
Endotoxin< 1.0 EU/μg of the protein as determined by the LAL method.
FormulationIf the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/mL. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Research Background
Functions as retinol transporter. Accepts all-trans retinol from the extracellular retinol-binding protein RBP4, facilitates retinol transport across the cell membrane, and then transfers retinol to the cytoplasmic retinol-binding protein RBP1. Retinol uptake is enhanced by LRAT, an enzyme that converts retinol to all-trans retinyl esters, the storage forms of vitamin A. Contributes to the activation of a signaling cascade that depends on retinol transport and LRAT-dependent generation of retinol metabolites that then trigger activation of JAK2 and its target STAT5, and ultimately increase the expression of SOCS3 and inhibit cellular responses to insulin. Important for the homeostasis of vitamin A and its derivatives, such as retinoic acid. STRA6-mediated transport is particularly important in the eye, and under conditions of dietary vitamin A deficiency. Does not transport retinoic acid.

Dose Conversion

You can also refer to dose conversion for different animals. More

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords