SARM1 Protein, Human, Recombinant (His & KSI)

Name: SARM1 Protein, Human, Recombinant (His & KSI)
Brand: TargetMol
SKU: TMPH-01741
Rating: 4.5 (1 reviews)

(Synonyms: Tir-1 homolog (HsTIR), Sterile alpha motif domain-containing protein 2 (MyD88-5;SAM domain-containing protein 2), Sterile alpha and TIR motif-containing protein 1, Sterile alpha and Armadillo repeat protein, SARM1, SARM, SAMD2, NADP(+) hydrolase SARM1, NADase SARM1, NAD(+) hydrolase SARM1, KIAA0524, hSARM1) Copy Product Info

Synonyms: Tir-1 homolog (HsTIR), Sterile alpha motif domain-containing protein 2 (MyD88-5;SAM domain-containing protein 2), Sterile alpha and TIR motif-containing protein 1, Sterile alpha and Armadillo repeat protein, SARM1, SARM, SAMD2, NADP(+) hydrolase SARM1, NADase SARM1, NAD(+) hydrolase SARM1, KIAA0524, hSARM1

Catalog No. TMPH-01741 Copy Product Info

SARM1 Protein, Human, Recombinant (His & KSI) is expressed in E. coli expression system with N-6xHis-KSI tag. The predicted molecular weight is 48.8 kDa and the accession number is Q6SZW1.

Pack Size	Price	USA Stock	Global Stock
5 µg	$105	20 days	20 days
10 µg	$169	20 days	20 days
20 µg	$283	20 days	20 days
50 µg	$428	20 days	20 days
100 µg	$590	20 days	20 days
200 µg	$913	20 days	20 days
500 µg	$1,620	20 days	20 days
1 mg	$2,530	20 days	20 days

For In stock only · Estimated delivery: USA Stock (1-2 days) Global Stock (5-7 days)

Add to Cart

Add to Quotation

For research use only—not for human use. No sales to individuals. Use as intended only.

Questions

Resource Download

User Guide of Recombinant Proteins

Product Introduction

Bioactivity

Bioactivity	Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description	SARM1 Protein, Human, Recombinant (His & KSI) is expressed in E. coli expression system with N-6xHis-KSI tag. The predicted molecular weight is 48.8 kDa and the accession number is Q6SZW1.
Species	Human
Expression System	E. coli
Tag	N-6xHis-KSI
Accession Number	Q6SZW1
Amino Acid	VPSWKEAEVQTWLQQIGFSKYCESFREQQVDGDLLLRLTEEELQTDLGMKSGITRKRFFRELTELKTFANYSTCDRSNLADWLGSLDPRFRQYTYGLVSCGLDRSLLHRVSEQQLLEDCGIHLGVHRARILTAAREMLHSPLPCTGGKPSGDTPDVFISYRRNSGSQLASLLKVHLQLHGFSVFIDVEKLEAGKFEDKLIQSVMGARNFVLVLSPGALDKCMQDHDCKDWVHKEIVTALSCGKNIVPIIDGFEWPEPQVLPEDMQAVLTFNGIKWSHEYQEATIEKIIRFLQGR
Construction	409-702 aa
Protein Purity	> 85% as determined by SDS-PAGE.
Endotoxin	< 1.0 EU/μg of the protein as determined by the LAL method.
Formulation	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/mL. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Synonyms	Tir-1 homolog (HsTIR), Sterile alpha motif domain-containing protein 2 (MyD88-5;SAM domain-containing protein 2), Sterile alpha and TIR motif-containing protein 1, Sterile alpha and Armadillo repeat protein, SARM1, SARM, SAMD2, NADP(+) hydrolase SARM1, NADase SARM1, NAD(+) hydrolase SARM1, KIAA0524, hSARM1
Research Background	NAD(+) hydrolase, which plays a key role in axonal degeneration following injury by regulating NAD(+) metabolism. Acts as a negative regulator of MYD88- and TRIF-dependent toll-like receptor signaling pathway by promoting Wallerian degeneration, an injury-induced form of programmed subcellular death which involves degeneration of an axon distal to the injury site. Wallerian degeneration is triggered by NAD(+) depletion: in response to injury, SARM1 is activated and catalyzes cleavage of NAD(+) into ADP-D-ribose (ADPR), cyclic ADPR (cADPR) and nicotinamide; NAD(+) cleavage promoting cytoskeletal degradation and axon destruction. Also able to hydrolyze NADP(+), but not other NAD(+)-related molecules. Can activate neuronal cell death in response to stress. Regulates dendritic arborization through the MAPK4-JNK pathway. Involved in innate immune response: inhibits both TICAM1/TRIF- and MYD88-dependent activation of JUN/AP-1, TRIF-dependent activation of NF-kappa-B and IRF3, and the phosphorylation of MAPK14/p38.

Chemical Properties

Molecular Weight

48.8 kDa (predicted)

Storage & Solubility Information

Shipping	In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.