IGF2/IGF-II Protein, Mouse, Recombinant (His)

Name: IGF2/IGF-II Protein, Mouse, Recombinant (His)
Brand: TargetMol
SKU: TMPH-02727
Price: 105 USD
Availability: InStock
Rating: 5 (10 reviews)

(Synonyms: Multiplication-stimulating polypeptide, Insulin-like growth factor II (IGF-II), Insulin-like growth factor 2, Igf-2, Igf2) Copy Product Info

Synonyms: Multiplication-stimulating polypeptide, Insulin-like growth factor II (IGF-II), Insulin-like growth factor 2, Igf-2, Igf2

Catalog No. TMPH-02727 Copy Product Info

IGF2/IGF-II Protein, Mouse, Recombinant (His) is expressed in E. coli expression system with N-6xHis tag. The predicted molecular weight is 13.4 kDa and the accession number is P09535.

Pack Size	Price	USA Stock	Global Stock
5 µg	$105	-	In Stock
10 µg	$169	-	In Stock
20 µg	$283	-	In Stock
50 µg	$428	20 days	20 days
100 µg	$590	20 days	20 days
200 µg	$913	20 days	20 days
500 µg	$1,620	20 days	20 days
1 mg	$2,530	20 days	20 days

For In stock only · Estimated delivery: USA Stock (1-2 days) Global Stock (5-7 days)

Add to Cart

Add to Quotation

For research use only—not for human use. No sales to individuals. Use as intended only.

Questions

Batch Information

Select Batch

Purity:90% (SDS-PAGE)

Appearance:Lyophilized powder

Color:White

Resource Download

COA User Guide of Recombinant Proteins

Product Introduction

Bioactivity

Bioactivity	Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description	IGF2/IGF-II Protein, Mouse, Recombinant (His) is expressed in E. coli expression system with N-6xHis tag. The predicted molecular weight is 13.4 kDa and the accession number is P09535.
Species	Mouse
Expression System	E. coli
Tag	N-6xHis
Accession Number	P09535
Amino Acid	AYGPGETLCGGELVDTLQFVCSDRGFYFSRPSSRANRRSRGIVEECCFRSCDLALLETYCATPAKSE
Construction	25-91 aa
Protein Purity	> 85% as determined by SDS-PAGE.
Endotoxin	< 1.0 EU/μg of the protein as determined by the LAL method.
Formulation	Tris-based buffer, 50% glycerol
Reconstitution	A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Synonyms	Multiplication-stimulating polypeptide, Insulin-like growth factor II (IGF-II), Insulin-like growth factor 2, Igf-2, Igf2
Research Background	The insulin-like growth factors possess growth-promoting activity. Major fetal growth hormone in mammals. Plays a key role in regulating fetoplacental development (Probable). IGF2 is influenced by placental lactogen (Probable). Also involved in tissue differentiation (Probable). In adults, involved in glucose metabolism in adipose tissue, skeletal muscle and liver (Probable). Acts as a ligand for integrin which is required for IGF2 signaling. Positively regulates myogenic transcription factor MYOD1 function by facilitating the recruitment of transcriptional coactivators, thereby controlling muscle terminal differentiation. Inhibits myoblast differentiation and modulates metabolism via increasing the mitochondrial respiration rate.; Preptin undergoes glucose-mediated co-secretion with insulin, and acts as physiological amplifier of glucose-mediated insulin secretion. Exhibits osteogenic properties by increasing osteoblast mitogenic activity through phosphoactivation of MAPK1 and MAPK3.

Chemical Properties

Molecular Weight

13.4 kDa (predicted)

Storage & Solubility Information

Shipping	In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.