Shopping Cart
Remove All
  • TargetMol
    Your shopping cart is currently empty

IGF2/IGF-II Protein, Mouse, Recombinant (His)

TargetMol | SPR Buffer-Exchangeable
Catalog No. TMPH-02727

IGF2/IGF-II Protein, Mouse, Recombinant (His) is expressed in E. coli expression system with N-6xHis tag. The predicted molecular weight is 13.4 kDa and the accession number is P09535.

IGF2/IGF-II Protein, Mouse, Recombinant (His)

IGF2/IGF-II Protein, Mouse, Recombinant (His)

TargetMol | SPR Buffer-Exchangeable
Catalog No. TMPH-02727
IGF2/IGF-II Protein, Mouse, Recombinant (His) is expressed in E. coli expression system with N-6xHis tag. The predicted molecular weight is 13.4 kDa and the accession number is P09535.
Pack SizePriceUSA WarehouseGlobal WarehouseQuantity
5 μg$10520 days20 days
10 μg$16920 days20 days
20 μg$28320 days20 days
50 μg$42820 days20 days
100 μg$59020 days20 days
200 μg$91320 days20 days
500 μg$1,62020 days20 days
1 mg$2,53020 days20 days
Add to Cart
Add to Quotation
In Stock Estimated shipping dateUSA Warehouse [1-2 days] Global Warehouse [5-7 days]
All TargetMol products are for research purposes only and cannot be used for human consumption. We do not provide products or services to individuals. Please comply with the intended use and do not use TargetMol products for any other purpose.
Questions
View More
Select Batch

Product Information

Biological Activity
Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description
IGF2/IGF-II Protein, Mouse, Recombinant (His) is expressed in E. coli expression system with N-6xHis tag. The predicted molecular weight is 13.4 kDa and the accession number is P09535.
Species
Mouse
Expression System
E. coli
TagN-6xHis
Accession NumberP09535
Synonyms
Multiplication-stimulating polypeptide,Insulin-like growth factor II (IGF-II),Insulin-like growth factor 2,Igf-2,Igf2
Amino Acid
AYGPGETLCGGELVDTLQFVCSDRGFYFSRPSSRANRRSRGIVEECCFRSCDLALLETYCATPAKSE
Construction
25-91 aa
Protein Purity
> 85% as determined by SDS-PAGE.
IGF2/IGF-II Protein, Mouse, Recombinant (His)
Molecular Weight13.4 kDa (predicted)
Endotoxin< 1.0 EU/μg of the protein as determined by the LAL method.
FormulationTris-based buffer, 50% glycerol
Reconstitution
A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice.
Research Background
The insulin-like growth factors possess growth-promoting activity. Major fetal growth hormone in mammals. Plays a key role in regulating fetoplacental development (Probable). IGF2 is influenced by placental lactogen (Probable). Also involved in tissue differentiation (Probable). In adults, involved in glucose metabolism in adipose tissue, skeletal muscle and liver (Probable). Acts as a ligand for integrin which is required for IGF2 signaling. Positively regulates myogenic transcription factor MYOD1 function by facilitating the recruitment of transcriptional coactivators, thereby controlling muscle terminal differentiation. Inhibits myoblast differentiation and modulates metabolism via increasing the mitochondrial respiration rate.; Preptin undergoes glucose-mediated co-secretion with insulin, and acts as physiological amplifier of glucose-mediated insulin secretion. Exhibits osteogenic properties by increasing osteoblast mitogenic activity through phosphoactivation of MAPK1 and MAPK3.

Dose Conversion

You can also refer to dose conversion for different animals. More

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords