SVEP1 Protein, Human, Recombinant (His)

Catalog No. TMPH-04142 Copy Product Info

SVEP1 Protein, Human, Recombinant (His) is expressed in E. coli with C-6xHis. The accession number is Q4LDE5.

SVEP1 Protein, Human, Recombinant (His)

Catalog No. TMPH-04142

Copy Product Info

SVEP1 Protein, Human, Recombinant (His) is expressed in E. coli with C-6xHis. The accession number is Q4LDE5.

Pack Size	Price	USA Stock	Global Stock
5 μg	$129	-	In Stock
10 μg	$216	-	In Stock
20 μg	$360	20 days	20 days
50 μg	$516	20 days	20 days
100 μg	$678	20 days	20 days
200 μg	$978	20 days	20 days
500 μg	$1,590	20 days	20 days
1 mg	$2,300	20 days	20 days

Add to Cart

Add to Quotation

For In stock only · Estimated delivery:USA Stock (1-2 days) Global Stock (5-7 days)

For research use only—not for human use. No sales to individuals. Use as intended only.

Questions

Batch Information

Select Batch

Resource Download

COA User Guide of Recombinant Proteins

Product Information

Biological Activity	Activity has not been tested. It is theoretically active, but we cannot guarantee it.
Description	SVEP1 Protein, Human, Recombinant (His) is expressed in E. coli with C-6xHis. The accession number is Q4LDE5.
Species	Human
Expression System	E. coli
Tag	C-6xHis
Accession Number	Q4LDE5
Synonyms	von Willebrand factor type A,SVEP1,Sushi, von Willebrand factor type A, EGF and pentraxin domain-containing protein 1,Serologically defined breast cancer antigen NY-BR-38,SELOB,Selectin-like osteoblast-derived protein (SEL-OB),Polydom,EGF and pentraxin domain-containing protein 1,CCP22,CCP module-containing protein 22,C9orf13
Amino Acid	GDFICTPDNTGVNCTLTCLEGYDFTEGSTDKYYCAYEDGVWKPTYTTEWPDCAKKRFANHGFKSFEMFYKAARCDDTDLMKKFSEAFETTLG
Construction	736-827 aa
Protein Purity	>95% as determined by SDS-PAGE.
Molecular Weight	17.6 kDa (Predicted)
Endotoxin	< 1.0 EU/μg of the protein as determined by the LAL method.
Formulation	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Stability & Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
Shipping	In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.