Home Tools
Log in
Cart

Carboxypeptidase D Protein, Human, Recombinant (His & Myc)

Catalog No. TMPH-01042
Synonyms: Carboxypeptidase D, CPD, gp180, Metallocarboxypeptidase D

Carboxypeptidase D Protein, Human, Recombinant (His & Myc) is expressed in Baculovirus insect cells with N-10xHis and C-Myc tag. The predicted molecular weight is 12.3 kDa and the accession number is O75976.

All products from TargetMol are for Research Use Only. Not for Human or Veterinary or Therapeutic Use.
Carboxypeptidase D Protein, Human, Recombinant (His & Myc)
Pack Size Availability Price/USD Quantity
20 μg 20 days $ 491.00
100 μg 20 days $ 1,370.00
500 μg 20 days $ 1,960.00
Bulk Inquiry
Get quote
Contact us for more batch information
Technical Params
Product Properties
Description Carboxypeptidase D Protein, Human, Recombinant (His & Myc) is expressed in Baculovirus insect cells with N-10xHis and C-Myc tag. The predicted molecular weight is 12.3 kDa and the accession number is O75976.
Species Human
Expression System Baculovirus
Tag N-terminal 10xHis-tagged and C-terminal Myc-tagged
Accession Number O75976
Synonyms Carboxypeptidase D, CPD, gp180, Metallocarboxypeptidase D
Amino Acid GVKGFVKDSITGSGLENATISVAGINHNITTGRFGDFYRLLVPGTYNLTVVLTGYMPLTVTNVVVKEGPATEVDFSLRP Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Construction 383-461 aa
Protein Purity > 85% as determined by SDS-PAGE.
Molecular Weight 12.3 kDa (predicted)
Formulation If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution A hardcopy of COA with reconstitution instructions is sent along with the products. Please refer to it for detailed information.
Stability & Storage

Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Shipping

In general, recombinant proteins are provided as lyophilized powder which are shipped at ambient temperature. Bulk packages of recombinant proteins are provided as frozen liquid. They are shipped out with blue ice unless customers require otherwise.

Calculator

Reconstitution Calculator
Recombinant Proteins Dilute Calculator
Specific Activity Calculator
=
÷
X
=
X
(Unit/mg)
= 106 ÷
ng/mL

bottom

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords

Carboxypeptidase D Protein, Human, Recombinant (His & Myc) Carboxypeptidase D CPD gp180 Metallocarboxypeptidase D recombinant recombinant-proteins proteins protein

 

TargetMol