LRP2 Protein, Human, Recombinant (mFc)

Name: LRP2 Protein, Human, Recombinant (mFc)
Brand: TargetMol
SKU: TMPH-01616
Rating: 4.5 (1 reviews)

(Synonyms: Megalin, LRP-2, LRP2, Low-density lipoprotein receptor-related protein 2, Glycoprotein 330 (gp330)) Copy Product Info

Synonyms: Megalin, LRP-2, LRP2, Low-density lipoprotein receptor-related protein 2, Glycoprotein 330 (gp330)

Catalog No. TMPH-01616 Copy Product Info

LRP2 Protein, Human, Recombinant (mFc) is expressed in HEK293 mammalian cells with C-mFc tag. The predicted molecular weight is 50.8 kDa and the accession number is P98164.

Customer service consultation

Pack Size	Price	USA Stock	Global Stock
5 μg	$133	20 days	20 days
10 μg	$219	20 days	20 days
20 μg	$368	20 days	20 days
50 μg	$678	20 days	20 days
100 μg	$1,080	20 days	20 days
200 μg	$1,680	20 days	20 days
500 μg	$2,970	20 days	20 days
1 mg	$4,770	20 days	20 days

For In stock only · Estimated delivery: USA Stock (1-2 days) Global Stock (5-7 days)

Add to Cart

Add to Quotation

For research use only—not for human use. No sales to individuals. Use as intended only.

Questions

Resource Download

User Guide of Recombinant Proteins

Product Introduction

Bioactivity

Bioactivity	Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description	LRP2 Protein, Human, Recombinant (mFc) is expressed in HEK293 mammalian cells with C-mFc tag. The predicted molecular weight is 50.8 kDa and the accession number is P98164.
Species	Human
Expression System	HEK293 Cells
Tag	C-mFc
Accession Number	P98164
Amino Acid	NCTASQFKCASGDKCIGVTNRCDGVFDCSDNSDEAGCPTRPPGMCHSDEFQCQEDGICIPNFWECDGHPDCLYGSDEHNACVPKTCPSSYFHCDNGNCIHRAWLCDRDNDCGDMSDEKDCPTQPFRCPSWQWQCLGHNICVNLSVVCDGIFDCPNGTDESPLCNGNSCSDFNGGCTHECVQEPFGAKCLCPLGFLLANDSKTCE
Construction	1186-1389 aa
Protein Purity	> 85% as determined by SDS-PAGE.
Endotoxin	< 1.0 EU/μg of the protein as determined by the LAL method.
Formulation	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/mL. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Stability & Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
Shipping	In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Synonyms	Megalin, LRP-2, LRP2, Low-density lipoprotein receptor-related protein 2, Glycoprotein 330 (gp330)
Research Background

Chemical Properties

Molecular Weight

50.8 kDa (predicted)

Storage & Solubility Information

Storage

Lyophilized powder: -20~-80°C for 1 year | Solution: -80°C for 6 months

Calculator

Molarity Calculator
Dilution Calculator
Reconstitution Calculator
Molecular Weight Calculator

Dose Conversion

You can also refer to dose conversion for different animals. More Dose Conversion

Tech Support

Please see Inhibitor Handling Instructions for more frequently ask questions. Topics include: how to prepare stock solutions, how to store products, and cautions on cell-based assays & animal experiments, etc

Keywords

LRP 2gp330gp 330

Related Tags: LRP2 Protein, Human, Recombinant (mFc) chemical structure | LRP2 Protein, Human, Recombinant (mFc) molecular weight