EGLN2 Protein, Human, Recombinant (His & SUMO)

Name: EGLN2 Protein, Human, Recombinant (His & SUMO)
Brand: TargetMol
SKU: TMPH-03905
Rating: 4.5 (1 reviews)

(Synonyms: Prolyl hydroxylase EGLN2, Prolyl hydroxylase domain-containing protein 1 (PHD1), Hypoxia-inducible factor prolyl hydroxylase 1 (HIF-PH1;HIF-prolyl hydroxylase 1;HPH-1), HPH-3, Estrogen-induced tag 6 (EIT-6), EIT6, EGLN2, Egl nine homolog 2) Copy Product Info

Synonyms: Prolyl hydroxylase EGLN2, Prolyl hydroxylase domain-containing protein 1 (PHD1), Hypoxia-inducible factor prolyl hydroxylase 1 (HIF-PH1;HIF-prolyl hydroxylase 1;HPH-1), HPH-3, Estrogen-induced tag 6 (EIT-6), EIT6, EGLN2, Egl nine homolog 2

Catalog No. TMPH-03905 Copy Product Info

EGLN2 Protein, Human, Recombinant (His & SUMO) is expressed in E. coli with N-6xHis-SUMO. The accession number is Q96KS0.

Customer service consultation

Pack Size	Price	USA Stock	Global Stock
5 μg	$75	20 days	20 days
10 μg	$119	20 days	20 days
20 μg	$198	20 days	20 days
50 μg	$288	20 days	20 days
100 μg	$389	20 days	20 days
200 μg	$589	20 days	20 days
500 μg	$1,070	20 days	20 days
1 mg	$1,680	20 days	20 days

For In stock only · Estimated delivery: USA Stock (1-2 days) Global Stock (5-7 days)

Add to Cart

Add to Quotation

For research use only—not for human use. No sales to individuals. Use as intended only.

Questions

Resource Download

User Guide of Recombinant Proteins

Product Introduction

Bioactivity

Bioactivity	Activity has not been tested. It is theoretically active, but we cannot guarantee it.
Description	EGLN2 Protein, Human, Recombinant (His & SUMO) is expressed in E. coli with N-6xHis-SUMO. The accession number is Q96KS0.
Species	Human
Expression System	E. coli
Tag	N-6xHis-SUMO
Accession Number	Q96KS0
Amino Acid	MVACYPGNGLGYVRHVDNPHGDGRCITCIYYLNQNWDVKVHGGLLQIFPEGRPVVANIEPLFDRLLIFWSDRRNPHEVKPAYATRYAITVWYFDAKERAAAKDKYQLASGQKGVQVPVSQPPTPT
Construction	283-407 aa
Protein Purity	>90% as determined by SDS-PAGE.
Endotoxin	< 1.0 EU/μg of the protein as determined by the LAL method.
Formulation	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Stability & Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
Shipping	In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Synonyms	Prolyl hydroxylase EGLN2, Prolyl hydroxylase domain-containing protein 1 (PHD1), Hypoxia-inducible factor prolyl hydroxylase 1 (HIF-PH1;HIF-prolyl hydroxylase 1;HPH-1), HPH-3, Estrogen-induced tag 6 (EIT-6), EIT6, EGLN2, Egl nine homolog 2

Chemical Properties

Molecular Weight

32.3 kDa (Predicted)

Storage & Solubility Information

Storage

Lyophilized powder: -20~-80°C for 1 year | Solution: -80°C for 6 months

Calculator

Molarity Calculator
Dilution Calculator
Reconstitution Calculator
Molecular Weight Calculator

Dose Conversion

You can also refer to dose conversion for different animals. More Dose Conversion

Tech Support

Please see Inhibitor Handling Instructions for more frequently ask questions. Topics include: how to prepare stock solutions, how to store products, and cautions on cell-based assays & animal experiments, etc

Keywords

PHD1PHD 1HPH3HIF-PH1HIF-PH 1EIT-6EIT 6EGLN 2Egl nine homolog2

Related Tags: EGLN2 Protein, Human, Recombinant (His & SUMO) chemical structure | EGLN2 Protein, Human, Recombinant (His & SUMO) molecular weight