Shopping Cart
- Remove All
- Your shopping cart is currently empty
Prolactin-Releasing Peptide (1-31) (rat) is a ligand for the UHR-1/GRP10 receptor, influencing fasting-induced food intake and increasing plasma levels of LH, FSH, and testosterone in rats [1] [2].
Pack Size | Price | Availability | Quantity |
---|---|---|---|
5 mg | Inquiry | Backorder | |
50 mg | Inquiry | Backorder |
Description | Prolactin-Releasing Peptide (1-31) (rat) is a ligand for the UHR-1/GRP10 receptor, influencing fasting-induced food intake and increasing plasma levels of LH, FSH, and testosterone in rats [1] [2]. |
Cas No. | 215510-06-8 |
Sequence | Ser-Arg-Ala-His-Gln-His-Ser-Met-Glu-Thr-Arg-Thr-Pro-Asp-Ile-Asn-Pro-Ala-Trp-Tyr-Thr-Gly-Arg-Gly-Ile-Arg-Pro-Val-Gly-Arg-Phe-NH2 |
Sequence Short | SRAHQHSMETRTPDINPAWYTGRGIRPVGRF-NH2 |
Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |
Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.