Shopping Cart
- Remove All
- Your shopping cart is currently empty
LY6G Protein, Mouse, Recombinant (His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 11.9 kDa and the accession number is P35461.
Pack Size | Price | Availability | Quantity |
---|---|---|---|
5 μg | $143 | 20 days | |
10 μg | $238 | 20 days | |
20 μg | $397 | 20 days | |
50 μg | $597 | 20 days | |
100 μg | $845 | 20 days | |
200 μg | $1,230 | 20 days | |
500 μg | $1,980 | 20 days | |
1 mg | $2,970 | 20 days |
Biological Activity | Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first. |
Description | LY6G Protein, Mouse, Recombinant (His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 11.9 kDa and the accession number is P35461. |
Species | Mouse |
Expression System | P. pastoris (Yeast) |
Tag | N-6xHis |
Accession Number | P35461 |
Synonyms | Lymphocyte antigen 6G,Ly-6G.1,Ly-6G,Ly6g |
Amino Acid | LECYNCIGVPPETSCNTTTCPFSDGFCVALEIEVIVDSHRSKVKSNLCLPICPTTLDNTEITGNAVNVKTYCCKEDLCNAAVPTGGSSWTMAG |
Construction | 27-119 aa |
Protein Purity | > 90% as determined by SDS-PAGE. |
Molecular Weight | 11.9 kDa (predicted) |
Endotoxin | < 1.0 EU/μg of the protein as determined by the LAL method. |
Formulation | Tris-based buffer, 50% glycerol |
Reconstitution | A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information. |
Stability & Storage | Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
Shipping | In general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice. |
Research Background | N/A |
Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.