Shopping Cart
Remove All
Your shopping cart is currently empty
GPBAR1 Protein-VLP, Mouse, Recombinant (His)
(Synonyms: Tgr5, Membrane-type receptor for bile acids (M-BAR), G-protein coupled bile acid receptor 1, Gpbar1) Copy Product InfoSynonyms: Tgr5, Membrane-type receptor for bile acids (M-BAR), G-protein coupled bile acid receptor 1, Gpbar1
Catalog No. TMPH-04490 Copy Product Info
GPBAR1 Protein-VLP, Mouse, Recombinant (His) is expressed in Mammalian cell. The accession number is Q80SS6.
Customer service consultation
| Pack Size | Price | USA Stock | Global Stock | Quantity |
|---|---|---|---|---|
| 5 μg | $313 | 20 days | 20 days | |
| 10 μg | $527 | 20 days | 20 days | |
| 20 μg | $889 | 20 days | 20 days | |
| 50 μg | $1,380 | 20 days | 20 days | |
| 100 μg | $1,990 | 20 days | 20 days | |
| 200 μg | $3,330 | 20 days | 20 days | |
| 500 μg | $6,650 | 20 days | 20 days |
For In stock only · Estimated delivery: USA Stock (1-2 days) Global Stock (5-7 days)
Add to Cart
Add to Quotation
For research use only—not for human use. No sales to individuals. Use as intended only.
Resource Download
Product Introduction
Bioactivity
Chemical Properties
Storage & Solubility Information
| Bioactivity | Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first. |
| Description | GPBAR1 Protein-VLP, Mouse, Recombinant (His) is expressed in Mammalian cell. The accession number is Q80SS6. |
| Species | Mouse |
| Expression System | HEK293 Cells |
| Tag | C-10xHis |
| Accession Number | Q80SS6 |
| Amino Acid | MMTPNSTELSAIPMGVLGLSLALASLIVIANLLLALGIALDRHLRSPPAGCFFLSLLLAGLLTGLALPMLPGLWSRNHQGYWSCLLLHLTPNFCFLSLLANLLLVHGERYMAVLQPLRPHGSVRLALFLTWVSSLFFASLPALGWNHWSPDANCSSQAVFPAPYLYLEVYGLLLPAVGATALLSVRVLATAHRQLCEIRRLERAVCRDVPSTLARALTWRQARAQAGATLLFLLCWGPYVATLLLSVLAYERRPPLGPGTLLSLISLGSTSAAAVPVAMGLGDQRYTAPWRTAAQRCLRVLRGRAKRDNPGPSTAYHTSSQCSIDLDLN |
| Construction | 1-329 aa |
| Protein Purity | The purity information is not available for VLPs proteins. |
| Endotoxin | Not tested. |
| Formulation | Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4 |
| Reconstitution | Reconstitute the lyophilized protein in distilled water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing. |
| Stability & Storage | Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 127 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
| Shipping | In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice. |
| Synonyms | Tgr5, Membrane-type receptor for bile acids (M-BAR), G-protein coupled bile acid receptor 1, Gpbar1 |
| Molecular Weight | 37.0 kDa (Predicted) |
| Storage | Lyophilized powder: -20~-80°C for 1 year | Solution: -80°C for 6 months |
Calculator
Dose Conversion
You can also refer to dose conversion for different animals. More Dose Conversion
Tech Support
Please see Inhibitor Handling Instructions for more frequently ask questions. Topics include: how to prepare stock solutions, how to store products, and cautions on cell-based assays & animal experiments, etc
Preview
Related Tags: GPBAR1 Protein-VLP, Mouse, Recombinant (His) chemical structure | GPBAR1 Protein-VLP, Mouse, Recombinant (His) molecular weight
Generate Quote
Catalog No.: Cas No.:
Add
| Size | Quantity | Unit Price | Amount | Operation |
|---|
Generate Quote
- TOP
Feedback
Hello! How can I help you today? 
Copyright © 2015-2026 TargetMol Chemicals Inc. All Rights Reserved.