Shopping Cart
- Remove All
- Your shopping cart is currently empty
This protein binds a wide variety of chemical odorants. Odorant-binding Protein, Bovine, Recombinant (His & SUMOstar) is expressed in yeast with N-6xHis-sumostar tag. The predicted molecular weight is 34.5 kDa and the accession number is P07435.
Pack Size | Price | Availability | Quantity |
---|---|---|---|
20 μg | $397 | 20 days | |
100 μg | $845 | 20 days | |
500 μg | $1,950 | 20 days |
Biological Activity | Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first. |
Description | This protein binds a wide variety of chemical odorants. Odorant-binding Protein, Bovine, Recombinant (His & SUMOstar) is expressed in yeast with N-6xHis-sumostar tag. The predicted molecular weight is 34.5 kDa and the accession number is P07435. |
Species | Bovine |
Expression System | P. pastoris (Yeast) |
Tag | N-6xHis-SUMOstar |
Accession Number | P07435 |
Synonyms | Olfactory mucosa pyrazine-binding protein,Odorant-binding protein,OBP |
Amino Acid | AQEEEAEQNLSELSGPWRTVYIGSTNPEKIQENGPFRTYFRELVFDDEKGTVDFYFSVKRDGKWKNVHVKATKQDDGTYVADYEGQNVFKIVSLSRTHLVAHNINVDKHGQTTELTELFVKLNVEDEDLEKFWKLTEDKGIDKKNVVNFLENEDHPHPE |
Construction | 1-159 aa |
Protein Purity | > 90% as determined by SDS-PAGE. |
Molecular Weight | 34.5 kDa (predicted) |
Endotoxin | < 1.0 EU/μg of the protein as determined by the LAL method. |
Formulation | Tris-based buffer, 50% glycerol |
Reconstitution | A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information. |
Stability & Storage | Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
Shipping | In general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice. |
Research Background | This protein binds a wide variety of chemical odorants. |
Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.