NOD2 Protein, Bovine, Recombinant (His & KSI)

Name: NOD2 Protein, Bovine, Recombinant (His & KSI)
Brand: TargetMol
SKU: TMPH-00289
Rating: 4.5 (1 reviews)

(Synonyms: Nucleotide-binding oligomerization domain-containing protein 2, NOD2, Caspase recruitment domain-containing protein 15, CARD15) Copy Product Info

Synonyms: Nucleotide-binding oligomerization domain-containing protein 2, NOD2, Caspase recruitment domain-containing protein 15, CARD15

Catalog No. TMPH-00289 Copy Product Info

NOD2 Protein, Bovine, Recombinant (His & KSI) is expressed in E. coli expression system with N-6xHis-KSI tag. The predicted molecular weight is 36.8 kDa and the accession number is Q6E804.

Customer service consultation

Pack Size	Price	USA Stock	Global Stock
5 µg	$129	20 days	20 days
10 µg	$216	20 days	20 days
20 µg	$360	20 days	20 days
50 µg	$543	20 days	20 days
100 µg	$745	20 days	20 days
200 µg	$1,070	20 days	20 days
500 µg	$1,730	20 days	20 days
1 mg	$2,530	20 days	20 days

For In stock only · Estimated delivery: USA Stock (1-2 days) Global Stock (5-7 days)

Add to Cart

Add to Quotation

For research use only—not for human use. No sales to individuals. Use as intended only.

Questions

Resource Download

User Guide of Recombinant Proteins

Product Introduction

Bioactivity

Bioactivity	Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description	NOD2 Protein, Bovine, Recombinant (His & KSI) is expressed in E. coli expression system with N-6xHis-KSI tag. The predicted molecular weight is 36.8 kDa and the accession number is Q6E804.
Species	Bovine
Expression System	E. coli
Tag	N-6xHis-KSI
Accession Number	Q6E804
Amino Acid	MCAQDAFQTQRSQLVELLVSGSLEGFESILDRLLSREVLSWEDYEGLSLVGQPISHLARRLLDTIWNKGTWGCEQLTAAVREAQADSQPPELPSSWDPHSPHPARDLQSHRPAIVRRLYGHVEGVLDLTQQRGFISQYETDEIRRPIFTSSQRARRLLDLATVKANGLAAFLLQCIQELPVPLALPFEDAA
Construction	1-191 aa
Protein Purity	> 85% as determined by SDS-PAGE.
Endotoxin	< 1.0 EU/μg of the protein as determined by the LAL method.
Formulation	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/mL. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Synonyms	Nucleotide-binding oligomerization domain-containing protein 2, NOD2, Caspase recruitment domain-containing protein 15, CARD15
Research Background	Involved in gastrointestinal immunity. Upon stimulation by muramyl dipeptide (MDP), a fragment of bacterial peptidoglycan, binds the proximal adapter receptor-interacting RIPK2, which recruits ubiquitin ligases as XIAP, BIRC2, BIRC3, INAVA and the LUBAC complex, triggering activation of MAP kinases and activation of NF-kappa-B signaling. This in turn leads to the transcriptional activation of hundreds of genes involved in immune response. Required for MDP-induced NLRP1-dependent CASP1 activation and IL1B release in macrophages. Component of an autophagy-mediated antibacterial pathway together with ATG16L1. Plays also a role in sensing single-stranded RNA (ssRNA) from viruses. Interacts with mitochondrial antiviral signaling/MAVS, leading to activation of interferon regulatory factor-3/IRF3 and expression of type I interferon.

Chemical Properties

Molecular Weight

36.8 kDa (predicted)

Storage & Solubility Information

Shipping	In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.