HSP90 Protein, Aspergillus fumigatus, Recombinant (His)

Name: HSP90 Protein, Aspergillus fumigatus, Recombinant (His)
Brand: TargetMol
SKU: TMPH-04787
Rating: 4.5 (1 reviews)

(Synonyms: hsp90, hsp1, Heat shock protein hsp1, Heat shock protein 90, 65 kDa IgE-binding protein) Copy Product Info

Synonyms: hsp90, hsp1, Heat shock protein hsp1, Heat shock protein 90, 65 kDa IgE-binding protein

Catalog No. TMPH-04787 Copy Product Info

HSP90 Protein, Aspergillus fumigatus, Recombinant (His) is expressed in E. coli. The accession number is P40292.

Customer service consultation

Pack Size	Price	USA Stock	Global Stock
5 μg	$143	20 days	20 days
10 μg	$235	20 days	20 days
20 μg	$393	20 days	20 days
50 μg	$568	20 days	20 days
100 μg	$756	20 days	20 days
200 μg	$1,080	20 days	20 days
500 μg	$1,760	20 days	20 days
1 mg	$2,550	20 days	20 days

For In stock only · Estimated delivery: USA Stock (1-2 days) Global Stock (5-7 days)

Add to Cart

Add to Quotation

For research use only—not for human use. No sales to individuals. Use as intended only.

Questions

Resource Download

User Guide of Recombinant Proteins

Product Introduction

Bioactivity


Description	HSP90 Protein, Aspergillus fumigatus, Recombinant (His) is expressed in E. coli. The accession number is P40292.
Species	Aspergillus fumigatus
Expression System	E. coli
Tag	N-6xHis
Accession Number	P40292
Amino Acid	MSSETFEFQAEISQLLSLIINTVYSNKEIFLRELISNASDALDKIRYQSLSDPTKLDTGKDLRIDIIPDKENKTLTIRDTGIGMTKADLINNLGTIARSGTKQFMEALSAGADISMIGQFGVGFYSAYLVADRVTVVSKNNDDEQYIWESAAGGTFTLTQDTEGEQLGRGTKIILHLKDEQTDYLNESRIKEVVRKHSEFISYPIYLHVL
Construction	1-210 aa
Protein Purity	> 90% as determined by SDS-PAGE.
Endotoxin	Not tested.
Formulation	Lyophilized from PBS, 6% Trehalose, pH 7.4
Reconstitution	Reconstitute the lyophilized protein in distilled water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Stability & Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 424 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
Shipping	In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Synonyms	hsp90, hsp1, Heat shock protein hsp1, Heat shock protein 90, 65 kDa IgE-binding protein

Chemical Properties

Molecular Weight

27.6 kDa (Predicted)

Storage & Solubility Information

Storage

Lyophilized powder: -20~-80°C for 1 year | Solution: -80°C for 6 months

Calculator

Molarity Calculator
Dilution Calculator
Reconstitution Calculator
Molecular Weight Calculator

Dose Conversion

You can also refer to dose conversion for different animals. More Dose Conversion

Tech Support

Please see Inhibitor Handling Instructions for more frequently ask questions. Topics include: how to prepare stock solutions, how to store products, and cautions on cell-based assays & animal experiments, etc

Related Tags: HSP90 Protein, Aspergillus fumigatus, Recombinant (His) chemical structure | HSP90 Protein, Aspergillus fumigatus, Recombinant (His) molecular weight