Shopping Cart
  • Remove All
  • TargetMol
    Your shopping cart is currently empty

FABP1 Protein, Mouse, Recombinant

Catalog No. TMPH-04270

FABP1 Protein, Mouse, Recombinant is expressed in E. coli with Tag Free. The accession number is P12710.

FABP1 Protein, Mouse, Recombinant

FABP1 Protein, Mouse, Recombinant

Catalog No. TMPH-04270
FABP1 Protein, Mouse, Recombinant is expressed in E. coli with Tag Free. The accession number is P12710.
Pack SizePriceAvailabilityQuantity
5 μg$13020 days
100 μg$1,08020 days
500 μg$2,43020 days
Bulk & Custom
Add to Cart
Questions
View More
All TargetMol products are for research purposes only and cannot be used for human consumption. We do not provide products or services to individuals. Please comply with the intended use and do not use TargetMol products for any other purpose.

Product Information

Biological Activity
Fully biologically active when compared to standard. The binding affinity of rMuFABP1 for the synthetic ligand cis-parinaric acid has been measured by fluorescence titration. Half maximal fluorescence of 2.5 μM rMuFABP1 is achieved with approximately 5 μM cis-paranaric acid.
Description
FABP1 Protein, Mouse, Recombinant is expressed in E. coli with Tag Free. The accession number is P12710.
Species
Mouse
Expression System
E. coli
TagTag Free
Accession NumberP12710
Synonyms
Liver-type fatty acid-binding protein (L-FABP),liver,Fatty acid-binding protein, liver,Fatty acid-binding protein 1,Fabpl,Fabp1,14 kDa selenium-binding protein
Amino Acid
MNFSGKYQLQSQENFEPFMKAIGLPEDLIQKGKDIKGVSEIVHEGKKIKLTITYGPKVVRNEFTLGEECELETMTGEKVKAVVKLEGDNKMVTTFKGIKSVTELNGDTITNTMTLGDIVYKRVSKRI
Construction
1-127 aa
Protein Purity
>95% as determined by SDS-PAGE.
Molecular Weight14.2 kDa (Predicted)
Endotoxin< 1.0 EU/μg of the protein as determined by the LAL method.
FormulationLyophilized from a 0.2 µm filtered concentrated solution in PBS, pH 7.4, 2 % trehalose.
Reconstitution
Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice.

Dose Conversion

You can also refer to dose conversion for different animals. More

Sci Citations

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords