Shopping Cart
Remove All
Your shopping cart is currently empty
FABP1 Protein, Mouse, Recombinant is expressed in E. coli with Tag Free. The accession number is P12710.

| Pack Size | Price | USA Stock | Global Stock | Quantity |
|---|---|---|---|---|
| 5 μg | $147 | 7-10 days | 7-10 days | |
| 10 μg | $223 | 7-10 days | 7-10 days | |
| 20 μg | $382 | 7-10 days | 7-10 days | |
| 50 μg | $739 | 7-10 days | 7-10 days | |
| 100 μg | $1,220 | 7-10 days | 7-10 days | |
| 200 μg | $1,720 | 7-10 days | 7-10 days | |
| 500 μg | $2,730 | 7-10 days | 7-10 days |
| Biological Activity | Fully biologically active when compared to standard. The binding affinity of rMuFABP1 for the synthetic ligand cis-parinaric acid has been measured by fluorescence titration. Half maximal fluorescence of 2.5 μM rMuFABP1 is achieved with approximately 5 μM cis-paranaric acid. |
| Description | FABP1 Protein, Mouse, Recombinant is expressed in E. coli with Tag Free. The accession number is P12710. |
| Species | Mouse |
| Expression System | E. coli |
| Tag | Tag Free |
| Accession Number | P12710 |
| Synonyms | Liver-type fatty acid-binding protein (L-FABP),liver,Fatty acid-binding protein, liver,Fatty acid-binding protein 1,Fabpl,Fabp1,14 kDa selenium-binding protein |
| Amino Acid | MNFSGKYQLQSQENFEPFMKAIGLPEDLIQKGKDIKGVSEIVHEGKKIKLTITYGPKVVRNEFTLGEECELETMTGEKVKAVVKLEGDNKMVTTFKGIKSVTELNGDTITNTMTLGDIVYKRVSKRI |
| Construction | 1-127 aa |
| Protein Purity | >95% as determined by SDS-PAGE. |
| Molecular Weight | 14.2 kDa (Predicted) |
| Endotoxin | < 1.0 EU/μg of the protein as determined by the LAL method. |
| Formulation | Lyophilized from a 0.2 µm filtered concentrated solution in PBS, pH 7.4, 2 % trehalose. |
| Reconstitution | Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing. |
| Stability & Storage | Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
| Shipping | In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice. |
| Size | Quantity | Unit Price | Amount | Operation |
|---|

Copyright © 2015-2026 TargetMol Chemicals Inc. All Rights Reserved.