Home Tools
Log in
Cart

ADAMTS13 Protein, Mouse, Recombinant (His & Myc)

Catalog No. TMPH-02484
Synonyms: ADAM-TS 1, A disintegrin and metalloproteinase with thrombospondin motifs 13, von Willebrand factor-cleaving protease, vWF-cleaving protease, vWF-CP, ADAMTS-13, ADAM-TS13

Cleaves the vWF multimers in plasma into smaller forms thereby controlling vWF-mediated platelet thrombus formation. ADAMTS13 Protein, Mouse, Recombinant (His & Myc) is expressed in E. coli expression system with N-10xHis and C-Myc tag. The predicted molecular weight is 32.7 kDa and the accession number is Q769J6.

All products from TargetMol are for Research Use Only. Not for Human or Veterinary or Therapeutic Use.
ADAMTS13 Protein, Mouse, Recombinant (His & Myc)
Pack Size Availability Price/USD Quantity
20 μg 20 days $ 360.00
100 μg 20 days $ 678.00
1 mg 20 days $ 2,300.00
Bulk Inquiry
Get quote
Contact us for more batch information
Biological Description
Technical Params
Product Properties
Description Cleaves the vWF multimers in plasma into smaller forms thereby controlling vWF-mediated platelet thrombus formation. ADAMTS13 Protein, Mouse, Recombinant (His & Myc) is expressed in E. coli expression system with N-10xHis and C-Myc tag. The predicted molecular weight is 32.7 kDa and the accession number is Q769J6.
Species Mouse
Expression System E. coli
Tag N-10xHis, C-Myc
Accession Number Q769J6
Synonyms ADAM-TS 1, A disintegrin and metalloproteinase with thrombospondin motifs 13, von Willebrand factor-cleaving protease, vWF-cleaving protease, vWF-CP, ADAMTS-13, ADAM-TS13
Amino Acid WTPLVGLCSISCGRGLKELYFLCMDSVLKMPVQEELCGLASKPPSRWEVCRARPCPARWETQVLAPCPVTCGGGRVPLSVRCVQLDRGHPISVPHSKCSPVPKPGSFEDCSPEPCPARWKVLSLGPCSASCGLGTATQMVACMQLDQGHDNEVNETFCKALVRPQASVPCLIADCAFRWHISAWTECSVSCGDGIQRRHDTCLGPQAQVPVPANFCQHLPKPMTVRGCWAGPCA
Construction 904-1137 aa
Protein Purity > 85% as determined by SDS-PAGE.
Molecular Weight 32.7 kDa (predicted)
Formulation Tris-based buffer, 50% glycerol
Reconstitution A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Stability & Storage

Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at-80℃. For reconstituted proteinsolutions, the solution can be stored at -20°c to -80'c for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.

Shipping

In general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice.

Research Background Cleaves the vWF multimers in plasma into smaller forms thereby controlling vWF-mediated platelet thrombus formation.

Calculator

Reconstitution Calculator
Recombinant Proteins Dilute Calculator
Specific Activity Calculator
=
÷
X
=
X
(Unit/mg)
= 106 ÷
ng/mL

bottom

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords

ADAMTS13 Protein, Mouse, Recombinant (His & Myc) ADAM-TS 1 A disintegrin and metalloproteinase with thrombospondin motifs 13 von Willebrand factor-cleaving protease vWF-cleaving protease vWF-CP ADAMTS-13 ADAM-TS13 recombinant recombinant-proteins proteins protein

 

TargetMol