ARID4B Protein, Human, Recombinant (His)

Name: ARID4B Protein, Human, Recombinant (His)
Brand: TargetMol
SKU: TMPH-00989
Rating: 4.5 (1 reviews)

(Synonyms: SAP180, Retinoblastoma-binding protein 1-like 1, RBP1L1, RBBP1L1, Histone deacetylase complex subunit SAP180, Breast cancer-associated antigen BRCAA1, BRCAA1, AT-rich interactive domain-containing protein 4B, ARID4B, ARID domain-containing protein 4B, 180 kDa Sin3-associated polypeptide (Sin3-associated polypeptide p180)) Copy Product Info

Synonyms: SAP180, Retinoblastoma-binding protein 1-like 1, RBP1L1, RBBP1L1, Histone deacetylase complex subunit SAP180, Breast cancer-associated antigen BRCAA1, BRCAA1, AT-rich interactive domain-containing protein 4B, ARID4B, ARID domain-containing protein 4B, 180 kDa Sin3-associated polypeptide (Sin3-associated polypeptide p180)

Catalog No. TMPH-00989 Copy Product Info

ARID4B Protein, Human, Recombinant (His) is expressed in E. coli expression system with N-6xHis tag. The predicted molecular weight is 32.8 kDa and the accession number is Q4LE39.

Customer service consultation

Pack Size	Price	USA Stock	Global Stock
5 µg	$129	20 days	20 days
10 µg	$216	20 days	20 days
20 µg	$360	20 days	20 days
50 µg	$543	20 days	20 days
100 µg	$745	20 days	20 days
200 µg	$1,070	20 days	20 days
500 µg	$1,730	20 days	20 days
1 mg	$2,530	20 days	20 days

For In stock only · Estimated delivery: USA Stock (1-2 days) Global Stock (5-7 days)

Add to Cart

Add to Quotation

For research use only—not for human use. No sales to individuals. Use as intended only.

Questions

Resource Download

User Guide of Recombinant Proteins

Product Introduction

Bioactivity

Bioactivity	Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description	ARID4B Protein, Human, Recombinant (His) is expressed in E. coli expression system with N-6xHis tag. The predicted molecular weight is 32.8 kDa and the accession number is Q4LE39.
Species	Human
Expression System	E. coli
Tag	N-6xHis
Accession Number	Q4LE39
Amino Acid	KQIDELLGKVVCVDYISLDKKKALWFPALVVCPDCSDEIAVKKDNILVRSFKDGKFTSVPRKDVHEITSDTAPKPDAVLKQAFEQALEFHKSRTIPANWKTELKEDSSSSEAEEEEEEEDDEKEKEDNSSEEEEEIEPFPEERENFLQQLYKFMEDRGTPINKRPVLGYRNLNLFKLFRLVHKLGGFDNIESGAVWKQVYQDLGIPVLNSAAGYNVKCAYKKYLYGFEEYCRSANIEFQMALPEKVVNK
Construction	167-415 aa
Protein Purity	> 85% as determined by SDS-PAGE.
Endotoxin	< 1.0 EU/μg of the protein as determined by the LAL method.
Formulation	Tris-based buffer, 50% glycerol
Reconstitution	A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Synonyms	SAP180, Retinoblastoma-binding protein 1-like 1, RBP1L1, RBBP1L1, Histone deacetylase complex subunit SAP180, Breast cancer-associated antigen BRCAA1, BRCAA1, AT-rich interactive domain-containing protein 4B, ARID4B, ARID domain-containing protein 4B, 180 kDa Sin3-associated polypeptide (Sin3-associated polypeptide p180)
Research Background	Acts as a transcriptional repressor. May function in the assembly and/or enzymatic activity of the Sin3A corepressor complex or in mediating interactions between the complex and other regulatory complexes. Plays a role in the regulation of epigenetic modifications at the PWS/AS imprinting center near the SNRPN promoter, where it might function as part of a complex with RB1 and ARID4A. Involved in spermatogenesis, together with ARID4A, where it functions as a transcriptional coactivator for AR (androgen receptor) and enhances expression of genes required for sperm maturation. Regulates expression of the tight junction protein CLDN3 in the testis, which is important for integrity of the blood-testis barrier. Plays a role in myeloid homeostasis where it regulates the histone methylation state of bone marrow cells and expression of various genes involved in hematopoiesis. May function as a leukemia suppressor.

Chemical Properties

Molecular Weight

32.8 kDa (predicted)

Storage & Solubility Information

Shipping	In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.