Shopping Cart
Remove All
  • TargetMol
    Your shopping cart is currently empty

CD3G Protein, Cynomolgus, Recombinant (His)

TargetMol | SPR Buffer-Exchangeable
Catalog No. TMPH-02435 Copy Product Info
CD3G Protein, Cynomolgus, Recombinant (His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 12.5 kDa and the accession number is Q95LI7.

CD3G Protein, Cynomolgus, Recombinant (His)

Catalog No. TMPH-02435
Copy Product Info
TargetMol | SPR Buffer-Exchangeable

CD3G Protein, Cynomolgus, Recombinant (His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 12.5 kDa and the accession number is Q95LI7.

CD3G Protein, Cynomolgus, Recombinant (His)
Pack SizePriceUSA StockGlobal StockQuantity
5 μg$14320 days20 days
10 μg$23820 days20 days
20 μg$39720 days20 days
50 μg$59720 days20 days
100 μg$84520 days20 days
Add to Cart
Add to Quotation
For In stock only · Estimated delivery:USA Stock (1-2 days) Global Stock (5-7 days)
For research use only—not for human use. No sales to individuals. Use as intended only.
Questions
View More

Batch Information

Product Information

Biological Activity
Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description
CD3G Protein, Cynomolgus, Recombinant (His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 12.5 kDa and the accession number is Q95LI7.
Species
Cynomolgus
Expression System
P. pastoris (Yeast)
TagN-6xHis
Accession NumberQ95LI7
Synonyms
T-cell surface glycoprotein CD3 gamma chain,T-cell receptor T3 gamma chain,CD3g
Amino Acid
QSFEENRKLNVYNQEDGSVLLTCHVKNTNITWFKEGKMIDILTAHKNKWNLGSNTKDPRGVYQCKGSKDKSKTLQVYYRMCQNCIELNAAT
Construction
23-113 aa
Protein Purity
> 90% as determined by SDS-PAGE.
Molecular Weight12.5 kDa (predicted)
Endotoxin< 1.0 EU/μg of the protein as determined by the LAL method.
FormulationTris-based buffer, 50% glycerol
Reconstitution
A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Research Background
Part of the TCR-CD3 complex present on T-lymphocyte cell surface that plays an essential role in adaptive immune response. When antigen presenting cells (APCs) activate T-cell receptor (TCR), TCR-mediated signals are transmitted across the cell membrane by the CD3 chains CD3D, CD3E, CD3G and CD3Z. All CD3 chains contain immunoreceptor tyrosine-based activation motifs (ITAMs) in their cytoplasmic domain. Upon TCR engagement, these motifs become phosphorylated by Src family protein tyrosine kinases LCK and FYN, resulting in the activation of downstream signaling pathways. In addition to this role of signal transduction in T-cell activation, CD3G plays an essential role in the dynamic regulation of TCR expression at the cell surface. Indeed, constitutive TCR cycling is dependent on the di-leucine-based (diL) receptor-sorting motif present in CD3G.

Dose Conversion

You can also refer to dose conversion for different animals. More

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords