Shopping Cart
Remove All
  • TargetMol
    Your shopping cart is currently empty

FABP1 Protein, Human, Recombinant (His)

Copy Product Info
TargetMol | SPR Buffer-Exchangeable
Catalog No. TMPH-03919

FABP1 Protein, Human, Recombinant (His) is expressed in Baculovirus Insect Cells with N-6xHis. The accession number is P07148.

FABP1 Protein, Human, Recombinant (His)

FABP1 Protein, Human, Recombinant (His)

Copy Product Info
TargetMol | SPR Buffer-Exchangeable
Catalog No. TMPH-03919
FABP1 Protein, Human, Recombinant (His) is expressed in Baculovirus Insect Cells with N-6xHis. The accession number is P07148.
Pack SizePriceUSA WarehouseGlobal WarehouseQuantity
5 μg$10820 days20 days
10 μg$17620 days20 days
20 μg$29320 days20 days
50 μg$52720 days20 days
100 μg$82620 days20 days
200 μg$1,07020 days20 days
500 μg$1,52020 days20 days
1 mg$1,98020 days20 days
Add to Cart
Add to Quotation
In Stock Estimated shipping dateUSA Warehouse [1-2 days] Global Warehouse [5-7 days]
All TargetMol products are for research purposes only and cannot be used for human consumption. We do not provide products or services to individuals. Please comply with the intended use and do not use TargetMol products for any other purpose.
Questions
View More

Product Information

Biological Activity
Activity has not been tested. It is theoretically active, but we cannot guarantee it.
Description
FABP1 Protein, Human, Recombinant (His) is expressed in Baculovirus Insect Cells with N-6xHis. The accession number is P07148.
Species
Human
Expression System
Baculovirus Insect Cells
TagN-6xHis
Accession NumberP07148
Synonyms
Liver-type fatty acid-binding protein (L-FABP),liver,Fatty acid-binding protein, liver,Fatty acid-binding protein 1,FABPL,FABP1
Amino Acid
MSFSGKYQLQSQENFEAFMKAIGLPEELIQKGKDIKGVSEIVQNGKHFKFTITAGSKVIQNEFTVGEECELETMTGEKVKTVVQLEGDNKLVTTFKNIKSVTELNGDIITNTMTLGDIVFKRISKRI
Construction
1-127 aa
Protein Purity
>85% as determined by SDS-PAGE.
Molecular Weight16.2 kDa (Predicted)
Endotoxin< 1.0 EU/μg of the protein as determined by the LAL method.
FormulationIf the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.

Dose Conversion

You can also refer to dose conversion for different animals. More

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords