Home Tools
Log in
Cart

Osteocalcin Protein, Rat, Recombinant (GST)

Catalog No. TMPH-03346

Constitutes 1-2% of the total bone protein. It binds strongly to apatite and calcium. Osteocalcin Protein, Rat, Recombinant (GST) is expressed in E. coli expression system with N-GST tag. The predicted molecular weight is 32.6 kDa and the accession number is P04640.

All products from TargetMol are for Research Use Only. Not for Human or Veterinary or Therapeutic Use.
Osteocalcin Protein, Rat, Recombinant (GST)
Pack Size Availability Price/USD Quantity
20 μg 20 days $ 284.00
100 μg 20 days $ 537.00
1 mg 20 days $ 2,300.00
Bulk Inquiry
Get quote
Contact us for more batch information
Biological Description
Technical Params
Product Properties
Description Constitutes 1-2% of the total bone protein. It binds strongly to apatite and calcium. Osteocalcin Protein, Rat, Recombinant (GST) is expressed in E. coli expression system with N-GST tag. The predicted molecular weight is 32.6 kDa and the accession number is P04640.
Species Rat
Expression System E. coli
Tag N-GST
Accession Number P04640
Amino Acid YLNNGLGAPAPYPDPLEPHREVCELNPNCDELADHIGFQDAYKRIYGTTV
Construction 50-99 aa
Protein Purity > 90% as determined by SDS-PAGE.
Molecular Weight 32.6 kDa (predicted)
Formulation Tris-based buffer, 50% glycerol
Reconstitution A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Stability & Storage

Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at-80℃. For reconstituted proteinsolutions, the solution can be stored at -20°c to -80'c for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.

Shipping

In general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice.

Research Background Constitutes 1-2% of the total bone protein. It binds strongly to apatite and calcium.

Calculator

Reconstitution Calculator
Recombinant Proteins Dilute Calculator
Specific Activity Calculator
=
÷
X
=
X
(Unit/mg)
= 106 ÷
ng/mL

bottom

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords

recombinant recombinant-proteins proteins protein

 

TargetMol