GPHB5 Protein, Mouse, Recombinant (His)

Catalog No. TMPH-02684

Functions as a heterodimeric glycoprotein hormone with GPHA2 able to bind and activate the thyroid-stimulating hormone receptor (TSHR), leading to increased cAMP production. Plays a central role in controlling thyroid cell metabolism. GPHB5 Protein, Mouse, Recombinant (His) is expressed in yeast with C-6xHis tag. The predicted molecular weight is 13.3 kDa and the accession number is Q812B2.

GPHB5 Protein, Mouse, Recombinant (His)

Catalog No. TMPH-02684

Pack Size	Price	Availability
5 μg	$143	20 days
10 μg	$238	20 days
20 μg	$397	20 days
50 μg	$597	20 days
100 μg	$845	20 days
200 μg	$1,190	20 days
500 μg	$1,950	20 days

Bulk & Custom

Add to Cart

All TargetMol products are for research purposes only and cannot be used for human consumption. We do not provide products or services to individuals. Please comply with the intended use and do not use TargetMol products for any other purpose.

Questions

Resource Download

User Guide of Recombinant Proteins

Product Information

Biological Activity	Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description	Functions as a heterodimeric glycoprotein hormone with GPHA2 able to bind and activate the thyroid-stimulating hormone receptor (TSHR), leading to increased cAMP production. Plays a central role in controlling thyroid cell metabolism. GPHB5 Protein, Mouse, Recombinant (His) is expressed in yeast with C-6xHis tag. The predicted molecular weight is 13.3 kDa and the accession number is Q812B2.
Species	Mouse
Expression System	P. pastoris (Yeast)
Tag	C-6xHis
Accession Number	Q812B2
Synonyms	Zlut1,Thyrostimulin subunit beta,Gphb5,Gpb5,Glycoprotein hormone beta-5
Amino Acid	SSSGNLHTFVGCAVREFTFMAKKPGCRGLRITTDACWGRCETWEKPILEPPYIEAYHRVCTYNETRQVTVKLPNCAPGVDPFYTYPMAVRCDCGACSTATTECETI
Construction	25-130 aa
Protein Purity	> 90% as determined by SDS-PAGE.
Molecular Weight	13.3 kDa (predicted)
Endotoxin	< 1.0 EU/μg of the protein as determined by the LAL method.
Formulation	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/mL. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Stability & Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
Shipping	In general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice.
Research Background	Functions as a heterodimeric glycoprotein hormone with GPHA2 able to bind and activate the thyroid-stimulating hormone receptor (TSHR), leading to increased cAMP production. Plays a central role in controlling thyroid cell metabolism.