Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.

MAPK14 Protein, Human, Recombinant (His & GST) is expressed in E. coli. The accession number is Q16539.

Human

E. coli

Stress-activated protein kinase 2a (SAPK2a),SAPK2A,MXI2,Mitogen-activated protein kinase p38 alpha (MAP kinase p38 alpha),Mitogen-activated protein kinase 14,MAX-interacting protein 2,MAPK14,MAP kinase MXI2,MAP kinase 14;MAPK 14,Cytokine suppressive anti-inflammatory drug-binding protein (CSAID-binding protein;CSBP),CSPB1,CSBP2,CSBP1,CSBP

SQERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPPLDQEEMES

2-360 aa

> 90% as determined by SDS-PAGE.

Reconstitute the lyophilized protein in distilled water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.

Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 241 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.