Shopping Cart
Remove All
  • TargetMol
    Your shopping cart is currently empty

p38 alpha/MAPK14 Protein, Human, Recombinant (His & GST)

TargetMol | SPR
Catalog No. TMPH-04604 Copy Product Info
p38 alpha/MAPK14 Protein, Human, Recombinant (His & GST) is expressed in E. coli. The accession number is Q16539.

p38 alpha/MAPK14 Protein, Human, Recombinant (His & GST)

Catalog No. TMPH-04604
Copy Product Info
TargetMol | SPR

p38 alpha/MAPK14 Protein, Human, Recombinant (His & GST) is expressed in E. coli. The accession number is Q16539.

p38 alpha/MAPK14 Protein, Human, Recombinant (His & GST)
Pack SizePriceUSA StockGlobal StockQuantity
5 μg$116-In Stock
10 μg$189-In Stock
20 μg$317-In Stock
50 μg$44820 days20 days
100 μg$588-In Stock
200 μg$91320 days20 days
500 μg$1,63020 days20 days
1 mg$2,55020 days20 days
Add to Cart
Add to Quotation
For In stock only · Estimated delivery:USA Stock (1-2 days) Global Stock (5-7 days)
For research use only—not for human use. No sales to individuals. Use as intended only.
Questions
View More

Batch Information

Select Batch

Product Information

Biological Activity
Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description
p38 alpha/MAPK14 Protein, Human, Recombinant (His & GST) is expressed in E. coli. The accession number is Q16539.
Species
Human
Expression System
E. coli
TagN-6xHis-GST
Accession NumberQ16539
Synonyms
Stress-activated protein kinase 2a (SAPK2a),SAPK2A,MXI2,Mitogen-activated protein kinase p38 alpha (MAP kinase p38 alpha),Mitogen-activated protein kinase 14,MAX-interacting protein 2,MAPK14,MAP kinase MXI2,MAP kinase 14;MAPK 14,Cytokine suppressive anti-inflammatory drug-binding protein (CSAID-binding protein;CSBP),CSPB1,CSBP2,CSBP1,CSBP
Amino Acid
SQERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPPLDQEEMES
Construction
2-360 aa
Protein Purity
> 90% as determined by SDS-PAGE.
p38 alpha/MAPK14 Protein, Human, Recombinant (His & GST)
Molecular Weight72.6 kDa (Predicted)
EndotoxinNot tested.
FormulationLyophilized from PBS, 6% Trehalose, pH 7.4
Reconstitution
Reconstitute the lyophilized protein in distilled water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 241 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.

Dose Conversion

You can also refer to dose conversion for different animals. More

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords