Shopping Cart
  • Remove All
  • TargetMol
    Your shopping cart is currently empty

MAPK14 Protein, Human, Recombinant (His & GST)

Catalog No. TMPH-04604

MAPK14 Protein, Human, Recombinant (His & GST) is expressed in E. coli. The accession number is Q16539.

MAPK14 Protein, Human, Recombinant (His & GST)

MAPK14 Protein, Human, Recombinant (His & GST)

Catalog No. TMPH-04604
MAPK14 Protein, Human, Recombinant (His & GST) is expressed in E. coli. The accession number is Q16539.
Pack SizePriceAvailabilityQuantity
20 μg$31720 days
100 μg$588In Stock
1 mg$2,55020 days
Bulk & Custom
Add to Cart
All TargetMol products are for research purposes only and cannot be used for human consumption. We do not provide products or services to individuals. Please comply with the intended use and do not use TargetMol products for any other purpose.
Questions
View More
Select Batch

Product Information

Biological Activity
Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description
MAPK14 Protein, Human, Recombinant (His & GST) is expressed in E. coli. The accession number is Q16539.
Species
Human
Expression System
E. coli
TagN-6xHis-GST
Accession NumberQ16539
Synonyms
Stress-activated protein kinase 2a (SAPK2a),SAPK2A,MXI2,Mitogen-activated protein kinase p38 alpha (MAP kinase p38 alpha),Mitogen-activated protein kinase 14,MAX-interacting protein 2,MAPK14,MAP kinase MXI2,MAP kinase 14;MAPK 14,Cytokine suppressive anti-inflammatory drug-binding protein (CSAID-binding protein;CSBP),CSPB1,CSBP2,CSBP1,CSBP
Amino Acid
SQERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPPLDQEEMES
Construction
2-360 aa
Protein Purity
> 90% as determined by SDS-PAGE.
MAPK14 Protein, Human, Recombinant (His & GST)
Molecular Weight72.6 kDa (Predicted)
EndotoxinNot tested.
FormulationLyophilized from PBS, 6% Trehalose, pH 7.4
Reconstitution
Reconstitute the lyophilized protein in distilled water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 241 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice.

Dose Conversion

You can also refer to dose conversion for different animals. More

Sci Citations

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords