Shopping Cart
- Remove All
- Your shopping cart is currently empty
Can constrain negative DNA supercoils. May be involved in maintaining the integrity of the genome at high temperature. Stimulates the Holliday junction cleavage activity of Hjc. Sso7d Protein, Sulfolobus solfataricus, Recombinant (His & SUMO) is expressed in E. coli expression system with N-6xHis-SUMO tag. The predicted molecular weight is 23.1 kDa and the accession number is P39476.
Pack Size | Price | Availability | Quantity |
---|---|---|---|
20 μg | $360 | 20 days | |
100 μg | $745 | 20 days | |
1 mg | $2,530 | 20 days |
Biological Activity | Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first. |
Description | Can constrain negative DNA supercoils. May be involved in maintaining the integrity of the genome at high temperature. Stimulates the Holliday junction cleavage activity of Hjc. Sso7d Protein, Sulfolobus solfataricus, Recombinant (His & SUMO) is expressed in E. coli expression system with N-6xHis-SUMO tag. The predicted molecular weight is 23.1 kDa and the accession number is P39476. |
Species | Sulfolobus solfataricus |
Expression System | E. coli |
Tag | N-6xHis-SUMO |
Accession Number | P39476 |
Synonyms | sso7d-1,sso7d,Sso7d,DNA-binding protein 7d,7 kDa DNA-binding protein d |
Amino Acid | ATVKFKYKGEEKEVDISKIKKVWRVGKMISFTYDEGGGKTGRGAVSEKDAPKELLQMLEKQKK |
Construction | 2-64 aa |
Protein Purity | > 90% as determined by SDS-PAGE. |
Molecular Weight | 23.1 kDa (predicted) |
Endotoxin | < 1.0 EU/μg of the protein as determined by the LAL method. |
Formulation | Tris-based buffer, 50% glycerol |
Reconstitution | A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information. |
Stability & Storage | Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
Shipping | In general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice. |
Research Background | Can constrain negative DNA supercoils. May be involved in maintaining the integrity of the genome at high temperature. Stimulates the Holliday junction cleavage activity of Hjc. |
Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.