Sso7d Protein, Sulfolobus solfataricus, Recombinant (His & SUMO)

Catalog No. TMPH-03611 Copy Product Info

Can constrain negative DNA supercoils. May be involved in maintaining the integrity of the genome at high temperature. Stimulates the Holliday junction cleavage activity of Hjc. Sso7d Protein, Sulfolobus solfataricus, Recombinant (His & SUMO) is expressed in E. coli expression system with N-6xHis-SUMO tag. The predicted molecular weight is 23.1 kDa and the accession number is P39476.

Sso7d Protein, Sulfolobus solfataricus, Recombinant (His & SUMO)

Catalog No. TMPH-03611

Copy Product Info

Sso7d Protein, Sulfolobus solfataricus, Recombinant (His & SUMO)

Pack Size	Price	USA Stock	Global Stock
5 μg	$129	20 days	20 days
10 μg	$216	20 days	20 days
20 μg	$360	20 days	20 days
50 μg	$543	20 days	20 days
100 μg	$745	20 days	20 days
200 μg	$1,070	20 days	20 days
500 μg	$1,730	20 days	20 days
1 mg	$2,530	20 days	20 days

Add to Cart

Add to Quotation

For In stock only · Estimated delivery:USA Stock (1-2 days) Global Stock (5-7 days)

For research use only—not for human use. No sales to individuals. Use as intended only.

Questions

Batch Information

Resource Download

User Guide of Recombinant Proteins

Product Information

Biological Activity	Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description	Can constrain negative DNA supercoils. May be involved in maintaining the integrity of the genome at high temperature. Stimulates the Holliday junction cleavage activity of Hjc. Sso7d Protein, Sulfolobus solfataricus, Recombinant (His & SUMO) is expressed in E. coli expression system with N-6xHis-SUMO tag. The predicted molecular weight is 23.1 kDa and the accession number is P39476.
Species	Sulfolobus solfataricus
Expression System	E. coli
Tag	N-6xHis-SUMO
Accession Number	P39476
Synonyms	sso7d-1,sso7d,DNA-binding protein 7d,7 kDa DNA-binding protein d
Amino Acid	ATVKFKYKGEEKEVDISKIKKVWRVGKMISFTYDEGGGKTGRGAVSEKDAPKELLQMLEKQKK
Construction	2-64 aa
Protein Purity	> 90% as determined by SDS-PAGE.
Molecular Weight	23.1 kDa (predicted)
Endotoxin	< 1.0 EU/μg of the protein as determined by the LAL method.
Formulation	Tris-based buffer, 50% glycerol
Reconstitution	A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Stability & Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
Shipping	In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Research Background	Can constrain negative DNA supercoils. May be involved in maintaining the integrity of the genome at high temperature. Stimulates the Holliday junction cleavage activity of Hjc.

Dose Conversion

You can also refer to dose conversion for different animals. More

Calculator

Reconstitution Calculator
Recombinant Protein Dilution Calculator
Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords

sso7d1