SNCG Protein, Mouse, Recombinant (hFc)

Catalog No. TMPH-04273

SNCG Protein, Mouse, Recombinant (hFc) is expressed in HEK293 Cells with C-hFc. The accession number is Q9Z0F7.

SNCG Protein, Mouse, Recombinant (hFc)

Catalog No. TMPH-04273

SNCG Protein, Mouse, Recombinant (hFc) is expressed in HEK293 Cells with C-hFc. The accession number is Q9Z0F7.

Pack Size	Price	USA Warehouse	Global Warehouse
5 μg	$100	20 days	20 days
10 μg	$162	20 days	20 days
20 μg	$269	20 days	20 days
50 μg	$353	20 days	20 days
100 μg	$437	20 days	20 days
200 μg	$798	20 days	20 days
500 μg	$1,780	20 days	20 days
1 mg	$3,280	20 days	20 days

Add to Cart

Add to Quotation

In Stock Estimated shipping dateUSA Warehouse [1-2 days] Global Warehouse [5-7 days]

All TargetMol products are for research purposes only and cannot be used for human consumption. We do not provide products or services to individuals. Please comply with the intended use and do not use TargetMol products for any other purpose.

Questions

Resource Download

User Guide of Recombinant Proteins

Product Information

Biological Activity	Activity has not been tested. It is theoretically active, but we cannot guarantee it.
Description	SNCG Protein, Mouse, Recombinant (hFc) is expressed in HEK293 Cells with C-hFc. The accession number is Q9Z0F7.
Species	Mouse
Expression System	HEK293 Cells
Tag	C-hFc
Accession Number	Q9Z0F7
Synonyms	Sncg,Persyn,Gamma-synuclein
Amino Acid	MDVFKKGFSIAKEGVVGAVEKTKQGVTEAAEKTKEGVMYVGTKTKENVVQSVTSVAEKTKEQANAVSEAVVSSVNTVANKTVEEAENIVVTTGVVRKEDLEPPAQDQEAKEQEENEEAKSGED
Construction	1-123 aa
Protein Purity	>85% as determined by SDS-PAGE.
Molecular Weight	42.0 kDa (Predicted)
Endotoxin	< 1.0 EU/μg of the protein as determined by the LAL method.
Formulation	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Stability & Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
Shipping	In general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice.

Dose Conversion

You can also refer to dose conversion for different animals. More

Calculator

Reconstitution Calculator
Recombinant Protein Dilution Calculator
Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords

γ-synuclein γsynuclein G-synuclein