Home Tools
Log in
Cart

CTGF/CCN2 Protein, Human, Recombinant (His)

Catalog No. TMPH-01069
Synonyms: Hypertrophic chondrocyte-specific protein 24, CCN family member 2, Insulin-like growth factor-binding protein 8, IGF-binding protein 8, IGFBP8, IGFBP-8, Cellular communication network factor 2, IBP-8, CCN2, Connective tissue growth factor, HCS24, CTGF

Major connective tissue mitoattractant secreted by vascular endothelial cells. Promotes proliferation and differentiation of chondrocytes. Mediates heparin- and divalent cation-dependent cell adhesion in many cell types including fibroblasts, myofibroblasts, endothelial and epithelial cells. Enhances fibroblast growth factor-induced DNA synthesis.

All products from TargetMol are for Research Use Only. Not for Human or Veterinary or Therapeutic Use.
CTGF/CCN2 Protein, Human, Recombinant (His)
Pack Size Availability Price/USD Quantity
20 μg 20 days $ 198.00
100 μg 20 days $ 389.00
1 mg 20 days $ 1,680.00
Bulk Inquiry
Get quote
Contact us for more batch information
Biological Description
Technical Params
Product Properties
Description Major connective tissue mitoattractant secreted by vascular endothelial cells. Promotes proliferation and differentiation of chondrocytes. Mediates heparin- and divalent cation-dependent cell adhesion in many cell types including fibroblasts, myofibroblasts, endothelial and epithelial cells. Enhances fibroblast growth factor-induced DNA synthesis.
Species Human
Expression System E. coli
Tag N-terminal 6xHis-tagged
Accession Number P29279
Synonyms Hypertrophic chondrocyte-specific protein 24, CCN family member 2, Insulin-like growth factor-binding protein 8, IGF-binding protein 8, IGFBP8, IGFBP-8, Cellular communication network factor 2, IBP-8, CCN2, Connective tissue growth factor, HCS24, CTGF
Amino Acid GKKCIRTPKISKPIKFELSGCTSMKTYRAKFCGVCTDGRCCTPHRTTTLPVEFKCPDGEVMKKNMMFIKTCACHYNCPGDNDIFESLYYRKMYGDMA Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Construction 253-349 aa
Protein Purity > 90% as determined by SDS-PAGE.
Molecular Weight 15.1 kDa (predicted)
Formulation Tris-based buffer,50% glycerol
Reconstitution A hardcopy of COA with reconstitution instructions is sent along with the products. Please refer to it for detailed information.
Stability & Storage

Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Shipping

In general, recombinant proteins are provided as lyophilized powder which are shipped at ambient temperature. Bulk packages of recombinant proteins are provided as frozen liquid. They are shipped out with blue ice unless customers require otherwise.

Research Background Major connective tissue mitoattractant secreted by vascular endothelial cells. Promotes proliferation and differentiation of chondrocytes. Mediates heparin- and divalent cation-dependent cell adhesion in many cell types including fibroblasts, myofibroblasts, endothelial and epithelial cells. Enhances fibroblast growth factor-induced DNA synthesis.

Calculator

Reconstitution Calculator
Recombinant Proteins Dilute Calculator
Specific Activity Calculator
=
÷
X
=
X
(Unit/mg)
= 106 ÷
ng/mL

bottom

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords

CTGF/CCN2 Protein, Human, Recombinant (His) Hypertrophic chondrocyte-specific protein 24 CCN family member 2 Insulin-like growth factor-binding protein 8 IGF-binding protein 8 IGFBP8 IGFBP-8 Cellular communication network factor 2 IBP-8 CCN2 Connective tissue growth factor HCS24 CTGF recombinant recombinant-proteins proteins protein

 

TargetMol