Major connective tissue mitoattractant secreted by vascular endothelial cells. Promotes proliferation and differentiation of chondrocytes. Mediates heparin- and divalent cation-dependent cell adhesion in many cell types including fibroblasts, myofibroblasts, endothelial and epithelial cells. Enhances fibroblast growth factor-induced DNA synthesis.
Pack Size | Availability | Price/USD | Quantity |
---|---|---|---|
20 μg | 20 days | $ 198.00 | |
100 μg | 20 days | $ 389.00 | |
1 mg | 20 days | $ 1,680.00 |
Description | Major connective tissue mitoattractant secreted by vascular endothelial cells. Promotes proliferation and differentiation of chondrocytes. Mediates heparin- and divalent cation-dependent cell adhesion in many cell types including fibroblasts, myofibroblasts, endothelial and epithelial cells. Enhances fibroblast growth factor-induced DNA synthesis. |
Species | Human |
Expression System | E. coli |
Tag | N-terminal 6xHis-tagged |
Accession Number | P29279 |
Synonyms | Hypertrophic chondrocyte-specific protein 24, CCN family member 2, Insulin-like growth factor-binding protein 8, IGF-binding protein 8, IGFBP8, IGFBP-8, Cellular communication network factor 2, IBP-8, CCN2, Connective tissue growth factor, HCS24, CTGF |
Amino Acid | GKKCIRTPKISKPIKFELSGCTSMKTYRAKFCGVCTDGRCCTPHRTTTLPVEFKCPDGEVMKKNMMFIKTCACHYNCPGDNDIFESLYYRKMYGDMA Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request. |
Construction | 253-349 aa |
Protein Purity | > 90% as determined by SDS-PAGE. |
Molecular Weight | 15.1 kDa (predicted) |
Formulation | Tris-based buffer,50% glycerol |
Reconstitution | A hardcopy of COA with reconstitution instructions is sent along with the products. Please refer to it for detailed information. |
Stability & Storage |
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
Shipping |
In general, recombinant proteins are provided as lyophilized powder which are shipped at ambient temperature. Bulk packages of recombinant proteins are provided as frozen liquid. They are shipped out with blue ice unless customers require otherwise. |
Research Background | Major connective tissue mitoattractant secreted by vascular endothelial cells. Promotes proliferation and differentiation of chondrocytes. Mediates heparin- and divalent cation-dependent cell adhesion in many cell types including fibroblasts, myofibroblasts, endothelial and epithelial cells. Enhances fibroblast growth factor-induced DNA synthesis. |
bottom
Please read the User Guide of Recombinant Proteins for more specific information.
CTGF/CCN2 Protein, Human, Recombinant (His) Hypertrophic chondrocyte-specific protein 24 CCN family member 2 Insulin-like growth factor-binding protein 8 IGF-binding protein 8 IGFBP8 IGFBP-8 Cellular communication network factor 2 IBP-8 CCN2 Connective tissue growth factor HCS24 CTGF recombinant recombinant-proteins proteins protein