Shopping Cart
- Remove All
- Your shopping cart is currently empty
lsdA Protein, S. aureus, Recombinant (His & Myc) is expressed in E. coli expression system with N-10xHis and C-Myc tag. The predicted molecular weight is 35.1 kDa and the accession number is Q6GA85.
Pack Size | Price | Availability | Quantity |
---|---|---|---|
5 μg | $129 | 20 days | |
10 μg | $216 | 20 days | |
20 μg | $360 | 20 days | |
50 μg | $543 | 20 days | |
100 μg | $745 | 20 days | |
200 μg | $1,070 | 20 days | |
500 μg | $1,730 | 20 days | |
1 mg | $2,530 | 20 days |
Biological Activity | Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first. |
Description | lsdA Protein, S. aureus, Recombinant (His & Myc) is expressed in E. coli expression system with N-10xHis and C-Myc tag. The predicted molecular weight is 35.1 kDa and the accession number is Q6GA85. |
Species | Staphylococcus aureus |
Expression System | E. coli |
Tag | N-10xHis, C-Myc |
Accession Number | Q6GA85 |
Synonyms | stbA,Staphylococcal transferrin-binding protein A,isdA,Iron-regulated surface determinant protein A,Fur-regulated protein A,frpA |
Amino Acid | ATEATNATNNQSTQVSQATSQPINFQVQKDGSSEKSHMDDYMQHPGKVIKQNNKYYFQTVLNNASFWKEYKFYNANNQELATTVVNDNKKADTRTINVAVEPGYKSLTTKVHIVVPQINYNHRYTTHLEFEKAIPTLADAAKPNNVKPVQPKPAQPKTPTEQTKPVQPKVEKVKPTVTTTSKVEDNHSTKVVSTDTTKDQTKTQTAHTVKTAQTAQEQNKVQTPVKDVATAKSESNNQAVSDNKSQQTNKVTKHNETPKQASKAKELPKT |
Construction | 47-316 aa |
Protein Purity | > 85% as determined by SDS-PAGE. |
Molecular Weight | 35.1 kDa (predicted) |
Endotoxin | < 1.0 EU/μg of the protein as determined by the LAL method. |
Formulation | Tris-based buffer, 50% glycerol |
Reconstitution | A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information. |
Stability & Storage | Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
Shipping | In general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice. |
Research Background | Cell wall-anchored surface receptor that participates in the extraction of heme from oxidized methemoglobin/metHb to enable growth on hemoglobin as a sole iron source. Receives heme from IsdB and transfers it to IsdC. Plays also a role in the inhibition of host immune response. Protects S.aureus against the bactericidal protease activity of apolactoferrin. Enhances bacterial cellular hydrophobicity, which renders S.aureus resistant to bactericidal human skin fatty acids as well as to beta-defensins and cathelicidin. Also binds fibronectin and chains B-beta and gamma of fibrinogen, promoting clumping of S.aureus with fibrinogen. Involved in adherence of S.aureus to human desquamated nasal epithelial cells and is required for nasal colonization. |
Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.