Home Tools
Log in
Cart

PBP 3 Protein, Bacillus subtilis, Recombinant (His)

Catalog No. TMPH-00169

Penicillin-binding proteins (PBPs) function in the late steps of murein biosynthesis. Probably required for both cortical and vegetative peptidoglycan synthesis. Although not usually required for cell division, in the absence of PBP 2B (pbpB) it becomes essential. Confers resistance to oxacillin and cephalexin. PBP 3 Protein, Bacillus subtilis, Recombinant (His) is expressed in E. coli expression system with N-6xHis tag. The predicted molecular weight is 29.2 kDa and the accession number is P42971.

All products from TargetMol are for Research Use Only. Not for Human or Veterinary or Therapeutic Use.
PBP 3 Protein, Bacillus subtilis, Recombinant (His)
Pack Size Availability Price/USD Quantity
20 μg 20 days $ 360.00
100 μg 20 days $ 678.00
1 mg 20 days $ 2,300.00
Bulk Inquiry
Get quote
Contact us for more batch information
Biological Description
Technical Params
Product Properties
Description Penicillin-binding proteins (PBPs) function in the late steps of murein biosynthesis. Probably required for both cortical and vegetative peptidoglycan synthesis. Although not usually required for cell division, in the absence of PBP 2B (pbpB) it becomes essential. Confers resistance to oxacillin and cephalexin. PBP 3 Protein, Bacillus subtilis, Recombinant (His) is expressed in E. coli expression system with N-6xHis tag. The predicted molecular weight is 29.2 kDa and the accession number is P42971.
Species Bacillus subtilis
Expression System E. coli
Tag N-6xHis
Accession Number P42971
Amino Acid CSKTDSPEDRMEAFVKQWNDQQFDDMYQSLTKDVKKEISKKDFVNRYKAIYEQAGVKNLKVTAGEVDKDDQDNKTMKHIPYKVSMNTNAGKVSFKNTAVLKLEKTDDEESWNIDWDPSFIFKQLADDKTVQIMSIEPKRGQIYDKNGKGLAVNTDVPEIGIVPGELGDKKEKVIKELAKKLDLTEDDIKKKLDQGWVKDDSFVPLKKVKPDQEKLVSEAT
Construction 21-240 aa
Protein Purity > 90% as determined by SDS-PAGE.
Molecular Weight 29.2 kDa (predicted)
Formulation Tris-based buffer, 50% glycerol
Reconstitution A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Stability & Storage

Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at-80℃. For reconstituted proteinsolutions, the solution can be stored at -20°c to -80'c for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.

Shipping

In general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice.

Research Background Penicillin-binding proteins (PBPs) function in the late steps of murein biosynthesis. Probably required for both cortical and vegetative peptidoglycan synthesis. Although not usually required for cell division, in the absence of PBP 2B (pbpB) it becomes essential. Confers resistance to oxacillin and cephalexin.

Calculator

Reconstitution Calculator
Recombinant Proteins Dilute Calculator
Specific Activity Calculator
=
÷
X
=
X
(Unit/mg)
= 106 ÷
ng/mL

bottom

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords

recombinant recombinant-proteins proteins protein

 

TargetMol