Shopping Cart
Remove All
  • TargetMol
    Your shopping cart is currently empty

PBP 3 Protein, Bacillus subtilis, Recombinant (His)

TargetMol | SPR Buffer-Exchangeable
Catalog No. TMPH-00169

Penicillin-binding proteins (PBPs) function in the late steps of murein biosynthesis. Probably required for both cortical and vegetative peptidoglycan synthesis. Although not usually required for cell division, in the absence of PBP 2B (pbpB) it becomes essential. Confers resistance to oxacillin and cephalexin. PBP 3 Protein, Bacillus subtilis, Recombinant (His) is expressed in E. coli expression system with N-6xHis tag. The predicted molecular weight is 29.2 kDa and the accession number is P42971.

PBP 3 Protein, Bacillus subtilis, Recombinant (His)

PBP 3 Protein, Bacillus subtilis, Recombinant (His)

TargetMol | SPR Buffer-Exchangeable
Catalog No. TMPH-00169
Penicillin-binding proteins (PBPs) function in the late steps of murein biosynthesis. Probably required for both cortical and vegetative peptidoglycan synthesis. Although not usually required for cell division, in the absence of PBP 2B (pbpB) it becomes essential. Confers resistance to oxacillin and cephalexin. PBP 3 Protein, Bacillus subtilis, Recombinant (His) is expressed in E. coli expression system with N-6xHis tag. The predicted molecular weight is 29.2 kDa and the accession number is P42971.
Pack SizePriceUSA WarehouseGlobal WarehouseQuantity
5 μg$12920 days20 days
10 μg$21620 days20 days
20 μg$36020 days20 days
50 μg$54320 days20 days
100 μg$74520 days20 days
200 μg$1,07020 days20 days
500 μg$1,73020 days20 days
1 mg$2,53020 days20 days
Add to Cart
Add to Quotation
In Stock Estimated shipping dateUSA Warehouse [1-2 days] Global Warehouse [5-7 days]
All TargetMol products are for research purposes only and cannot be used for human consumption. We do not provide products or services to individuals. Please comply with the intended use and do not use TargetMol products for any other purpose.
Questions
View More

Product Information

Biological Activity
Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description
Penicillin-binding proteins (PBPs) function in the late steps of murein biosynthesis. Probably required for both cortical and vegetative peptidoglycan synthesis. Although not usually required for cell division, in the absence of PBP 2B (pbpB) it becomes essential. Confers resistance to oxacillin and cephalexin. PBP 3 Protein, Bacillus subtilis, Recombinant (His) is expressed in E. coli expression system with N-6xHis tag. The predicted molecular weight is 29.2 kDa and the accession number is P42971.
Species
Bacillus subtilis
Expression System
E. coli
TagN-6xHis
Accession NumberP42971
Synonyms
yzsA,ycsM,PSPB20,Penicillin-binding protein C,Penicillin-binding protein 3,pbpC,PBP 3
Amino Acid
CSKTDSPEDRMEAFVKQWNDQQFDDMYQSLTKDVKKEISKKDFVNRYKAIYEQAGVKNLKVTAGEVDKDDQDNKTMKHIPYKVSMNTNAGKVSFKNTAVLKLEKTDDEESWNIDWDPSFIFKQLADDKTVQIMSIEPKRGQIYDKNGKGLAVNTDVPEIGIVPGELGDKKEKVIKELAKKLDLTEDDIKKKLDQGWVKDDSFVPLKKVKPDQEKLVSEAT
Construction
21-240 aa
Protein Purity
> 90% as determined by SDS-PAGE.
Molecular Weight29.2 kDa (predicted)
Endotoxin< 1.0 EU/μg of the protein as determined by the LAL method.
FormulationTris-based buffer, 50% glycerol
Reconstitution
A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice.
Research Background
Penicillin-binding proteins (PBPs) function in the late steps of murein biosynthesis. Probably required for both cortical and vegetative peptidoglycan synthesis. Although not usually required for cell division, in the absence of PBP 2B (pbpB) it becomes essential. Confers resistance to oxacillin and cephalexin.

Dose Conversion

You can also refer to dose conversion for different animals. More

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords