ITIH4 Protein, Human, Recombinant (His)

Catalog No. TMPH-01541 Copy Product Info

Type II acute-phase protein (APP) involved in inflammatory responses to trauma. May also play a role in liver development or regeneration.

ITIH4 Protein, Human, Recombinant (His)

Catalog No. TMPH-01541

Copy Product Info

Type II acute-phase protein (APP) involved in inflammatory responses to trauma. May also play a role in liver development or regeneration.

Pack Size	Price	USA Stock	Global Stock
5 μg	$125	20 days	20 days
10 μg	$198	20 days	20 days
20 μg	$341	20 days	20 days
50 μg	$497	20 days	20 days
100 μg	$696	20 days	20 days
200 μg	$1,070	20 days	20 days
500 μg	$1,890	20 days	20 days
1 mg	$2,970	20 days	20 days

Add to Cart

Add to Quotation

For In stock only · Estimated delivery:USA Stock (1-2 days) Global Stock (5-7 days)

For research use only—not for human use. No sales to individuals. Use as intended only.

Questions

Batch Information

Resource Download

User Guide of Recombinant Proteins

Product Information

Biological Activity	Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description	Type II acute-phase protein (APP) involved in inflammatory responses to trauma. May also play a role in liver development or regeneration.
Species	Human
Expression System	P. pastoris (Yeast)
Tag	N-6xHis
Accession Number	Q14624
Synonyms	Plasma kallikrein sensitive glycoprotein 120 (Gp120;PK-120),PK120,ITIHL1,ITI-HC4,ITIH4,ITI heavy chain H4,Inter-alpha-trypsin inhibitor heavy chain H4,Inter-alpha-trypsin inhibitor family heavy chain-related protein (IHRP),Inter-alpha-inhibitor heavy chain 4,IHRP
Amino Acid	RLAILPASAPPATSNPDPAVSRVMNMKIEETTMTTQTPAPIQAPSAILPLPGQSVERLCVDPRHRQGPVNLLSDPEQGVEVTGQYEREKAGFSWIEVTFKNPLVWVHASPEHVVVTRNRRSSAYKWKETLFSVMPGLKMTMDKTGLLLLSDPDKVTIGLLFWDGRGEGLRLLLRDTDRFSSHVGGTLGQFYQEVLWGSPAASDDGRRTLRVQGNDHSATRERRLDYQEGPPGVEISCWSVEL
Construction	689-930 aa
Protein Purity	> 85% as determined by SDS-PAGE.
Molecular Weight	28.9 kDa (predicted)
Endotoxin	< 1.0 EU/μg of the protein as determined by the LAL method.
Formulation	Tris-based buffer, 50% glycerol
Reconstitution	A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Stability & Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
Shipping	In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Research Background	Type II acute-phase protein (APP) involved in inflammatory responses to trauma. May also play a role in liver development or regeneration.