keep away from moisture
Powder: -20°C for 3 years | In solvent: -80°C for 1 year
FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is an Exendin-4 peptide derivative.
Pack Size | Availability | Price/USD | Quantity |
---|---|---|---|
5 mg | Inquiry | Inquiry | |
50 mg | Inquiry | Inquiry |
Description | FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is an Exendin-4 peptide derivative. |
Molecular Weight | 3692.15 |
Formula | 3692.15 |
keep away from moisture
Powder: -20°C for 3 years | In solvent: -80°C for 1 year
You can also refer to dose conversion for different animals. More
bottom
Please see Inhibitor Handling Instructions for more frequently ask questions. Topics include: how to prepare stock solutions, how to store products, and cautions on cell-based assays & animal experiments, etc.
FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS inhibitor inhibit