Shopping Cart
- Remove All
Your shopping cart is currently empty
Gastrin-Releasing Peptide, human is a regulatory human peptide that elicits gastrin release and regulates gastric acid secretion and enteric motor function. The post-ganglionic fibers of the vagus nerve that innervate the G cells of the stomach release GRP, which stimulates the G cells to release gastrin.

| Pack Size | Price | Availability | Quantity |
|---|---|---|---|
| 1 mg | $1,330 | 35 days |
| Description | Gastrin-Releasing Peptide, human is a regulatory human peptide that elicits gastrin release and regulates gastric acid secretion and enteric motor function. The post-ganglionic fibers of the vagus nerve that innervate the G cells of the stomach release GRP, which stimulates the G cells to release gastrin. |
| Molecular Weight | 2859.38 |
| Formula | C130H204N38O31S2 |
| Cas No. | 93755-85-2 |
| Relative Density. | 1.46 g/cm3 (Predicted) |
| Sequence | Val-Pro-Leu-Pro-Ala-Gly-Gly-Gly-Thr-Val-Leu-Thr-Lys-Met-Tyr-Pro-Arg-Gly-Asn-His-Trp-Ala-Val-Gly-His-Leu-Met-NH2 |
| Sequence Short | VPLPAGGGTVLTKMYPRGNHWAVGHLM-NH2 |
| Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |
| Solubility Information | H2O: Soluble |

Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.