Shopping Cart
- Remove All
- Your shopping cart is currently empty
SLC10A1 Protein-VLP, Human, Recombinant (His) is expressed in Mammalian cell. The accession number is Q14973.
Pack Size | Price | Availability | Quantity |
---|---|---|---|
20 μg | $889 | In Stock | |
100 μg | $1,990 | 20 days | |
1 mg | $11,200 | 20 days |
Biological Activity | Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first. |
Description | SLC10A1 Protein-VLP, Human, Recombinant (His) is expressed in Mammalian cell. The accession number is Q14973. |
Species | Human |
Expression System | HEK293 Cells |
Tag | C-10xHis |
Accession Number | Q14973 |
Synonyms | Solute carrier family 10 member 1 (SLC10A1),Sodium/taurocholate cotransporting polypeptide (NTCP),SLC10A1,NTCP,Na(+)/taurocholate transport protein,Na(+)/bile acid cotransporter,Hepatic sodium/bile acid cotransporter,Cell growth-inhibiting gene 29 protein |
Amino Acid | MEAHNASAPFNFTLPPNFGKRPTDLALSVILVFMLFFIMLSLGCTMEFSKIKAHLWKPKGLAIALVAQYGIMPLTAFVLGKVFRLKNIEALAILVCGCSPGGNLSNVFSLAMKGDMNLSIVMTTCSTFCALGMMPLLLYIYSRGIYDGDLKDKVPYKGIVISLVLVLIPCTIGIVLKSKRPQYMRYVIKGGMIIILLCSVAVTVLSAINVGKSIMFAMTPLLIATSSLMPFIGFLLGYVLSALFCLNGRCRRTVSMETGCQNVQLCSTILNVAFPPEVIGPLFFFPLLYMIFQLGEGLLLIAIFWCYEKFKTPKDKTKMIYTAATTEETIPGALGNGTYKGEDCSPCTA |
Construction | 1-349 aa |
Protein Purity | The purity information is not available for VLPs proteins. |
Molecular Weight | 39.5 kDa (Predicted) |
Endotoxin | Not tested. |
Formulation | Lyophilized from a 0.2 μm sterile filtered PBS, pH 7.4 |
Reconstitution | Reconstitute the lyophilized protein in distilled water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing. |
Stability & Storage | Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 273 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
Shipping | In general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice. |
Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.