SLC10A1 Protein-VLP, Human, Recombinant (His)

Name: SLC10A1 Protein-VLP, Human, Recombinant (His)
Brand: TargetMol
SKU: TMPH-04636
Rating: 4.5 (1 reviews)

(Synonyms: Solute carrier family 10 member 1 (SLC10A1), Sodium/taurocholate cotransporting polypeptide (NTCP), SLC10A1, NTCP, Na(+)/taurocholate transport protein, Na(+)/bile acid cotransporter, Hepatic sodium/bile acid cotransporter, Cell growth-inhibiting gene 29 protein) Copy Product Info

Synonyms: Solute carrier family 10 member 1 (SLC10A1), Sodium/taurocholate cotransporting polypeptide (NTCP), SLC10A1, NTCP, Na(+)/taurocholate transport protein, Na(+)/bile acid cotransporter, Hepatic sodium/bile acid cotransporter, Cell growth-inhibiting gene 29 protein

Catalog No. TMPH-04636 Copy Product Info

SLC10A1 Protein-VLP, Human, Recombinant (His) is expressed in Mammalian cell. The accession number is Q14973.

Customer service consultation

Pack Size	Price	USA Stock	Global Stock
5 µg	$313	20 days	20 days
10 µg	$527	20 days	20 days
20 µg	$889	-	In Stock
50 µg	$1,380	20 days	20 days
100 µg	$1,990	20 days	20 days
200 µg	$3,330	20 days	20 days
500 µg	$6,650	20 days	20 days

For In stock only · Estimated delivery: USA Stock (1-2 days) Global Stock (5-7 days)

Add to Cart

Add to Quotation

For research use only—not for human use. No sales to individuals. Use as intended only.

Questions

Batch Information

Select Batch

Purity:The purity information is not available for VLPs proteins.

Appearance:Lyophilized powder

Color:White

Resource Download

COA User Guide of Recombinant Proteins

Product Introduction

Bioactivity

Bioactivity	Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description	SLC10A1 Protein-VLP, Human, Recombinant (His) is expressed in Mammalian cell. The accession number is Q14973.
Species	Human
Expression System	HEK293 Cells
Tag	C-10xHis
Accession Number	Q14973
Amino Acid	MEAHNASAPFNFTLPPNFGKRPTDLALSVILVFMLFFIMLSLGCTMEFSKIKAHLWKPKGLAIALVAQYGIMPLTAFVLGKVFRLKNIEALAILVCGCSPGGNLSNVFSLAMKGDMNLSIVMTTCSTFCALGMMPLLLYIYSRGIYDGDLKDKVPYKGIVISLVLVLIPCTIGIVLKSKRPQYMRYVIKGGMIIILLCSVAVTVLSAINVGKSIMFAMTPLLIATSSLMPFIGFLLGYVLSALFCLNGRCRRTVSMETGCQNVQLCSTILNVAFPPEVIGPLFFFPLLYMIFQLGEGLLLIAIFWCYEKFKTPKDKTKMIYTAATTEETIPGALGNGTYKGEDCSPCTA
Construction	1-349 aa
Protein Purity	The purity information is not available for VLPs proteins.
Endotoxin	Not tested.
Formulation	Lyophilized from a 0.2 μm sterile filtered PBS, pH 7.4
Reconstitution	Reconstitute the lyophilized protein in distilled water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Synonyms	Solute carrier family 10 member 1 (SLC10A1), Sodium/taurocholate cotransporting polypeptide (NTCP), SLC10A1, NTCP, Na(+)/taurocholate transport protein, Na(+)/bile acid cotransporter, Hepatic sodium/bile acid cotransporter, Cell growth-inhibiting gene 29 protein

Chemical Properties

Molecular Weight

39.5 kDa (Predicted)

Storage & Solubility Information

Shipping	In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 273 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.