Shopping Cart
Remove All
  • TargetMol
    Your shopping cart is currently empty

OBP2A Protein, Human, Recombinant (C114S & K127N, His & SUMO)

TargetMol | SPR Buffer-Exchangeable
Catalog No. TMPH-01806 Copy Product Info
Probably binds and transports small hydrophobic volatile molecules with a higher affinity for aldehydes and large fatty acids. OBP2A Protein, Human, Recombinant (C114S & K127N, His & SUMO) is expressed in E. coli expression system with N-6xHis-SUMO tag. The predicted molecular weight is 30.8 kDa and the accession number is Q9NY56.

OBP2A Protein, Human, Recombinant (C114S & K127N, His & SUMO)

Catalog No. TMPH-01806
Copy Product Info
TargetMol | SPR Buffer-Exchangeable

Probably binds and transports small hydrophobic volatile molecules with a higher affinity for aldehydes and large fatty acids. OBP2A Protein, Human, Recombinant (C114S & K127N, His & SUMO) is expressed in E. coli expression system with N-6xHis-SUMO tag. The predicted molecular weight is 30.8 kDa and the accession number is Q9NY56.

OBP2A Protein, Human, Recombinant (C114S & K127N, His & SUMO)
Pack SizePriceUSA StockGlobal StockQuantity
5 μg$7520 days20 days
10 μg$11920 days20 days
20 μg$19820 days20 days
50 μg$29720 days20 days
100 μg$42720 days20 days
200 μg$65820 days20 days
500 μg$1,17020 days20 days
1 mg$1,83020 days20 days
Add to Cart
Add to Quotation
For In stock only · Estimated delivery:USA Stock (1-2 days) Global Stock (5-7 days)
For research use only—not for human use. No sales to individuals. Use as intended only.
Questions
View More

Batch Information

Product Information

Biological Activity
Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description
Probably binds and transports small hydrophobic volatile molecules with a higher affinity for aldehydes and large fatty acids. OBP2A Protein, Human, Recombinant (C114S & K127N, His & SUMO) is expressed in E. coli expression system with N-6xHis-SUMO tag. The predicted molecular weight is 30.8 kDa and the accession number is Q9NY56.
Species
Human
Expression System
E. coli
TagN-6xHis-SUMO
Accession NumberQ9NY56
Synonyms
Odorant-binding protein IIa (OBPIIa),Odorant-binding protein 2a,OBP2A
Amino Acid
LSFTLEEEDITGTWYVKAMVVDKDFPEDRRPRKVSPVKVTALGGGNLEATFTFMREDRCIQKKILMRKTEEPGKFSAYGGRKLIYLQELPGTDDYVFYSKDQRRGGLRYMGNLVGRNPNTNLEALEEFKKLVQHKGLSEEDIFMPLQTGSCVLEH
Construction
16-170 aa (C114S,K127N)
Protein Purity
> 90% as determined by SDS-PAGE.
Molecular Weight30.8 kDa (predicted)
Endotoxin< 1.0 EU/μg of the protein as determined by the LAL method.
FormulationIf the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/mL. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Research Background
Probably binds and transports small hydrophobic volatile molecules with a higher affinity for aldehydes and large fatty acids.

Citations

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Dose Conversion

You can also refer to dose conversion for different animals. More

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords