Home Tools
Log in
Cart

TNFSF4 Protein, Rabbit, Recombinant (His)

Catalog No. TMPH-03216

Cytokine that binds to TNFRSF4. Co-stimulates T-cell proliferation and cytokine production. TNFSF4 Protein, Rabbit, Recombinant (His) is expressed in E. coli expression system with N-6xHis tag. The predicted molecular weight is 20.1 kDa and the accession number is O02765.

All products from TargetMol are for Research Use Only. Not for Human or Veterinary or Therapeutic Use.
TNFSF4 Protein, Rabbit, Recombinant (His)
Pack Size Availability Price/USD Quantity
20 μg 20 days $ 360.00
100 μg 20 days $ 678.00
1 mg 20 days $ 2,300.00
Bulk Inquiry
Get quote
Contact us for more batch information
Biological Description
Technical Params
Product Properties
Description Cytokine that binds to TNFRSF4. Co-stimulates T-cell proliferation and cytokine production. TNFSF4 Protein, Rabbit, Recombinant (His) is expressed in E. coli expression system with N-6xHis tag. The predicted molecular weight is 20.1 kDa and the accession number is O02765.
Species Rabbit
Expression System E. coli
Tag N-6xHis
Accession Number O02765
Amino Acid QHSHAPEVSLQYPPIENIMTQLQILTSHECEEDSFILPLQKRDGTMEVQNNSVVIQCDGFYLLSLKGYFSQEVSISLHYRKGEEPFPILKKTKFANSNVVLKLGYKDKVYLNVTTDSASCKQLSVNAGELIVILQNPGGYCAP
Construction 45-187 aa
Protein Purity > 90% as determined by SDS-PAGE.
Molecular Weight 20.1 kDa (predicted)
Formulation If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Stability & Storage

Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at-80℃. For reconstituted proteinsolutions, the solution can be stored at -20°c to -80'c for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.

Shipping

In general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice.

Research Background Cytokine that binds to TNFRSF4. Co-stimulates T-cell proliferation and cytokine production.

Calculator

Reconstitution Calculator
Recombinant Proteins Dilute Calculator
Specific Activity Calculator
=
÷
X
=
X
(Unit/mg)
= 106 ÷
ng/mL

bottom

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords

recombinant recombinant-proteins proteins protein

 

TargetMol