Home Tools
Log in
Cart

ACKR1 Protein, Human, Recombinant (His)

Catalog No. TMPH-00990
Synonyms: Glycoprotein D, Duffy antigen/chemokine receptor, Atypical chemokine receptor 1, Plasmodium vivax receptor, GpFy, CD234, Fy glycoprotein

ACKR1 Protein, Human, Recombinant (His) is expressed in in vitro E. coli expression system.

All products from TargetMol are for Research Use Only. Not for Human or Veterinary or Therapeutic Use.
ACKR1 Protein, Human, Recombinant (His)
Pack Size Availability Price/USD Quantity
20 μg 20 days $ 1,950.00
100 μg 20 days $ 3,210.00
Bulk Inquiry
Get quote
Contact us for more batch information
Biological Description
Technical Params
Product Properties
Description ACKR1 Protein, Human, Recombinant (His) is expressed in in vitro E. coli expression system.
Species Human
Expression System in vitro E. coli expression system
Tag N-terminal 10xHis-tagged
Accession Number Q16570
Synonyms Glycoprotein D, Duffy antigen/chemokine receptor, Atypical chemokine receptor 1, Plasmodium vivax receptor, GpFy, CD234, Fy glycoprotein
Amino Acid MGNCLHRAELSPSTENSSQLDFEDVWNSSYGVNDSFPDGDYGANLEAAAPCHSCNLLDDSALPFFILTSVLGILASSTVLFMLFRPLFRWQLCPGWPVLAQLAVGSALFSIVVPVLAPGLGSTRSSALCSLGYCVWYGSAFAQALLLGCHASLGHRLGAGQVPGLTLGLTVGIWGVAALLTLPVTLASGASGGLCTLIYSTELKALQATHTVACLAIFVLLPLGLFGAKGLKKALGMGPGPWMNILWAWFIFWWPHGVVLGLDFLVRSKLLLLSTCLAQQALDLLLNLAEALAILHCVATPLLLALFCHQATRTLLPSLPLPEGWSSHLDTLGSKS
Construction 1-336 aa
Protein Purity > 85% as determined by SDS-PAGE.
Molecular Weight 41.1 kDa as predicted
Formulation Tris-based buffer,50% glycerol
Reconstitution A hardcopy of COA with reconstitution instructions is sent along with the products. Please refer to it for detailed information.
Stability & Storage

Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Shipping

In general, recombinant proteins are provided as lyophilized powder which are shipped at ambient temperature. Bulk packages of recombinant proteins are provided as frozen liquid. They are shipped out with blue ice unless customers require otherwise.

Research Background Atypical chemokine receptor that controls chemokine levels and localization via high-affinity chemokine binding that is uncoupled from classic ligand-driven signal transduction cascades, resulting instead in chemokine sequestration, degradation, or transcytosis. Also known as interceptor (internalizing receptor) or chemokine-scavenging receptor or chemokine decoy receptor. Has a promiscuous chemokine-binding profile, interacting with inflammatory chemokines of both the CXC and the CC subfamilies but not with homeostatic chemokines. Acts as a receptor for chemokines including CCL2, CCL5, CCL7, CCL11, CCL13, CCL14, CCL17, CXCL5, CXCL6, IL8/CXCL8, CXCL11, GRO, RANTES, MCP-1, TARC and also for the malaria parasites P.vivax and P.knowlesi. May regulate chemokine bioavailability and, consequently, leukocyte recruitment through two distinct mechanisms: when expressed in endothelial cells, it sustains the abluminal to luminal transcytosis of tissue-derived chemokines and their subsequent presentation to circulating leukocytes; when expressed in erythrocytes, serves as blood reservoir of cognate chemokines but also as a chemokine sink, buffering potential surges in plasma chemokine levels.

Calculator

Reconstitution Calculator
Recombinant Proteins Dilute Calculator
Specific Activity Calculator
=
÷
X
=
X
(Unit/mg)
= 106 ÷
ng/mL

bottom

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords

ACKR1 Protein, Human, Recombinant (His) Glycoprotein D Duffy antigen/chemokine receptor Atypical chemokine receptor 1 Plasmodium vivax receptor GpFy CD234 Fy glycoprotein recombinant recombinant-proteins proteins protein

 

TargetMol