May play a role in the terminally differentiating and the adult nervous system during postnatal development. Could stabilize interactions between hyaluronan (HA) and brain proteoglycans. Isoform 2 may function as a chondroitin sulfate-bearing cell surface receptor.
Pack Size | Availability | Price/USD | Quantity |
---|---|---|---|
20 μg | 20 days | $ 614.00 | |
100 μg | 20 days | $ 1,720.00 | |
1 mg | 20 days | $ 7,240.00 |
Description | May play a role in the terminally differentiating and the adult nervous system during postnatal development. Could stabilize interactions between hyaluronan (HA) and brain proteoglycans. Isoform 2 may function as a chondroitin sulfate-bearing cell surface receptor. |
Species | Rat |
Expression System | HEK293 |
Tag | C-terminal hFC-tagged |
Accession Number | P55068 |
Synonyms | Bcan, Behab, BEHAB, Brevican core protein, Brain-enriched hyaluronan-binding protein |
Amino Acid | DVGLHFCSPGWEPFQGACYKHFSTRRSWEEAESQCRALGAHLTSICTPEEQDFVNDRYREYQWIGLNDRTIEGDFLWSDGPPLLYENWNPGQPDSYFLSGENCVVMVWHDQGQWSDVPCNYHLSYTCKM Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request. |
Construction | 658-786 aa |
Protein Purity | > 85% as determined by SDS-PAGE. |
Molecular Weight | 44 kDa (predicted) |
Formulation | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | A hardcopy of COA with reconstitution instructions is sent along with the products. Please refer to it for detailed information. |
Stability & Storage |
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
Shipping |
In general, recombinant proteins are provided as lyophilized powder which are shipped at ambient temperature. Bulk packages of recombinant proteins are provided as frozen liquid. They are shipped out with blue ice unless customers require otherwise. |
Research Background | May play a role in the terminally differentiating and the adult nervous system during postnatal development. Could stabilize interactions between hyaluronan (HA) and brain proteoglycans. Isoform 2 may function as a chondroitin sulfate-bearing cell surface receptor. |
bottom
Please read the User Guide of Recombinant Proteins for more specific information.
BCAN Protein, Rat, Recombinant (hFc) Bcan Behab BEHAB Brevican core protein Brain-enriched hyaluronan-binding protein recombinant recombinant-proteins proteins protein