Shopping Cart
  • Remove All
  • TargetMol
    Your shopping cart is currently empty

Galectin-4/LGALS4 Protein, Rat, Recombinant

Catalog No. TMPH-03299

Galectin that binds lactose and a related range of sugars. Galectin-4/LGALS4 Protein, Rat, Recombinant is expressed in E. coli expression system. The predicted molecular weight is 36.3 kDa and the accession number is P38552.

Galectin-4/LGALS4 Protein, Rat, Recombinant

Galectin-4/LGALS4 Protein, Rat, Recombinant

Catalog No. TMPH-03299
Galectin that binds lactose and a related range of sugars. Galectin-4/LGALS4 Protein, Rat, Recombinant is expressed in E. coli expression system. The predicted molecular weight is 36.3 kDa and the accession number is P38552.
Pack SizePriceAvailabilityQuantity
20 μg$51520 days
100 μg$91620 days
1 mg$2,69020 days
Bulk & Custom
Add to Cart
All TargetMol products are for research purposes only and cannot be used for human consumption. We do not provide products or services to individuals. Please comply with the intended use and do not use TargetMol products for any other purpose.
Questions
View More

Product Information

Biological Activity
Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description
Galectin that binds lactose and a related range of sugars. Galectin-4/LGALS4 Protein, Rat, Recombinant is expressed in E. coli expression system. The predicted molecular weight is 36.3 kDa and the accession number is P38552.
Species
Rat
Expression System
E. coli
TagTag Free
Accession NumberP38552
Synonyms
Lgals4,Lactose-binding lectin 4,L-36 lactose-binding protein (L36LBP),Galectin-4,Gal-4
Amino Acid
MAYVPAPGYQPTYNPTLPYKRPIPGGLSVGMSIYIQGIAKDNMRRFHVNFAVGQDEGADIAFHFNPRFDGWDKVVFNTMQSGQWGKEEKKKSMPFQKGHHFELVFMVMSEHYKVVVNGTPFYEYGHRLPLQMVTHLQVDGDLELQSINFLGGQPAASQYPGTMTIPAYPSAGYNPPQMNSLPVMAGPPIFNPPVPYVGTLQGGLTARRTIIIKGYVLPTAKNLIINFKVGSTGDIAFHMNPRIGDCVVRNSYMNGSWGSEERKIPYNPFGAGQFFDLSIRCGTDRFKVFANGQHLFDFSHRFQAFQRVDMLEIKGDITLSYVQI
Construction
1-324 aa
Protein Purity
> 85% as determined by SDS-PAGE.
Molecular Weight36.3 kDa (predicted)
Endotoxin< 1.0 EU/μg of the protein as determined by the LAL method.
FormulationTris-based buffer, 50% glycerol
Reconstitution
A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice.
Research Background
Galectin that binds lactose and a related range of sugars.

Dose Conversion

You can also refer to dose conversion for different animals. More

Sci Citations

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords